BLASTX nr result
ID: Panax25_contig00036599
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00036599 (487 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011031011.1 PREDICTED: CMP-sialic acid transporter 5-like [Po... 58 7e-07 XP_011022792.1 PREDICTED: CMP-sialic acid transporter 5-like [Po... 58 7e-07 XP_002310563.1 hypothetical protein POPTR_0007s05460g [Populus t... 58 7e-07 XP_002307086.2 hypothetical protein POPTR_0005s07710g [Populus t... 58 7e-07 XP_017247824.1 PREDICTED: CMP-sialic acid transporter 5 [Daucus ... 58 7e-07 KDO36447.1 hypothetical protein CISIN_1g029315mg [Citrus sinensis] 57 7e-07 OAY35840.1 hypothetical protein MANES_12G134900 [Manihot esculenta] 57 1e-06 XP_016573209.1 PREDICTED: CMP-sialic acid transporter 5 isoform ... 57 1e-06 XP_016573208.1 PREDICTED: CMP-sialic acid transporter 5 isoform ... 57 1e-06 XP_010268000.1 PREDICTED: CMP-sialic acid transporter 5 [Nelumbo... 57 1e-06 OAY35841.1 hypothetical protein MANES_12G134900 [Manihot esculenta] 57 1e-06 XP_016573206.1 PREDICTED: CMP-sialic acid transporter 5 isoform ... 57 1e-06 XP_015076314.1 PREDICTED: CMP-sialic acid transporter 5 [Solanum... 57 1e-06 XP_004240015.1 PREDICTED: CMP-sialic acid transporter 5 [Solanum... 57 1e-06 XP_009594352.1 PREDICTED: CMP-sialic acid transporter 5 [Nicotia... 57 1e-06 KJB40375.1 hypothetical protein B456_007G060800 [Gossypium raimo... 57 1e-06 CDP01452.1 unnamed protein product [Coffea canephora] 57 2e-06 KZV53752.1 hypothetical protein F511_00018 [Dorcoceras hygrometr... 57 2e-06 XP_017638417.1 PREDICTED: CMP-sialic acid transporter 5-like [Go... 57 2e-06 XP_016694994.1 PREDICTED: CMP-sialic acid transporter 5-like [Go... 57 2e-06 >XP_011031011.1 PREDICTED: CMP-sialic acid transporter 5-like [Populus euphratica] Length = 327 Score = 57.8 bits (138), Expect = 7e-07 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -3 Query: 128 SEPYTHICFCFVPVLVASVLLGLTSALCQWASQVKKRTSYLM 3 S+P + + +PVLVASVL GL SALCQWASQVKK +SYLM Sbjct: 169 SDPEQILFYGIIPVLVASVLSGLASALCQWASQVKKHSSYLM 210 >XP_011022792.1 PREDICTED: CMP-sialic acid transporter 5-like [Populus euphratica] Length = 327 Score = 57.8 bits (138), Expect = 7e-07 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -3 Query: 128 SEPYTHICFCFVPVLVASVLLGLTSALCQWASQVKKRTSYLM 3 S+P + + +PVLVASVL GL SALCQWASQVKK +SYLM Sbjct: 169 SDPEQILFYGIIPVLVASVLSGLASALCQWASQVKKHSSYLM 210 >XP_002310563.1 hypothetical protein POPTR_0007s05460g [Populus trichocarpa] EEE91013.1 hypothetical protein POPTR_0007s05460g [Populus trichocarpa] Length = 327 Score = 57.8 bits (138), Expect = 7e-07 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -3 Query: 128 SEPYTHICFCFVPVLVASVLLGLTSALCQWASQVKKRTSYLM 3 S+P + + +PVLVASVL GL SALCQWASQVKK +SYLM Sbjct: 169 SDPEQILFYGIIPVLVASVLSGLASALCQWASQVKKHSSYLM 210 >XP_002307086.2 hypothetical protein POPTR_0005s07710g [Populus trichocarpa] EEE94082.2 hypothetical protein POPTR_0005s07710g [Populus trichocarpa] Length = 327 Score = 57.8 bits (138), Expect = 7e-07 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -3 Query: 128 SEPYTHICFCFVPVLVASVLLGLTSALCQWASQVKKRTSYLM 3 S+P + + +PVLVASVL GL SALCQWASQVKK +SYLM Sbjct: 169 SDPEQILFYGIIPVLVASVLSGLASALCQWASQVKKHSSYLM 210 >XP_017247824.1 PREDICTED: CMP-sialic acid transporter 5 [Daucus carota subsp. sativus] KZM98413.1 hypothetical protein DCAR_014225 [Daucus carota subsp. sativus] Length = 331 Score = 57.8 bits (138), Expect = 7e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 125 EPYTHICFCFVPVLVASVLLGLTSALCQWASQVKKRTSYLM 3 +P + + VPVL+ASVL GL SALCQWASQVKKR+SYLM Sbjct: 174 DPDEILFYGIVPVLIASVLSGLASALCQWASQVKKRSSYLM 214 >KDO36447.1 hypothetical protein CISIN_1g029315mg [Citrus sinensis] Length = 195 Score = 56.6 bits (135), Expect = 7e-07 Identities = 30/38 (78%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = -3 Query: 113 HICFC-FVPVLVASVLLGLTSALCQWASQVKKRTSYLM 3 HI F VPVLVASVL GL SALCQWASQVKK +SYLM Sbjct: 41 HILFYGIVPVLVASVLSGLASALCQWASQVKKHSSYLM 78 >OAY35840.1 hypothetical protein MANES_12G134900 [Manihot esculenta] Length = 261 Score = 57.0 bits (136), Expect = 1e-06 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -3 Query: 128 SEPYTHICFCFVPVLVASVLLGLTSALCQWASQVKKRTSYLM 3 S P + + VPVLVASVL GL SALCQWASQVKK +SYLM Sbjct: 103 SNPDQILFYGIVPVLVASVLSGLASALCQWASQVKKHSSYLM 144 >XP_016573209.1 PREDICTED: CMP-sialic acid transporter 5 isoform X3 [Capsicum annuum] Length = 302 Score = 57.0 bits (136), Expect = 1e-06 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -3 Query: 128 SEPYTHICFCFVPVLVASVLLGLTSALCQWASQVKKRTSYLM 3 S P + + VPVLVASVL GL SALCQWASQVKK +SYLM Sbjct: 144 SNPDQILFYGIVPVLVASVLSGLASALCQWASQVKKHSSYLM 185 >XP_016573208.1 PREDICTED: CMP-sialic acid transporter 5 isoform X2 [Capsicum annuum] Length = 305 Score = 57.0 bits (136), Expect = 1e-06 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -3 Query: 128 SEPYTHICFCFVPVLVASVLLGLTSALCQWASQVKKRTSYLM 3 S P + + VPVLVASVL GL SALCQWASQVKK +SYLM Sbjct: 172 SNPDQILFYGIVPVLVASVLSGLASALCQWASQVKKHSSYLM 213 >XP_010268000.1 PREDICTED: CMP-sialic acid transporter 5 [Nelumbo nucifera] Length = 327 Score = 57.0 bits (136), Expect = 1e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 95 VPVLVASVLLGLTSALCQWASQVKKRTSYLM 3 VPVLVASVL GL SALCQWASQVKK TSYLM Sbjct: 180 VPVLVASVLSGLASALCQWASQVKKHTSYLM 210 >OAY35841.1 hypothetical protein MANES_12G134900 [Manihot esculenta] Length = 330 Score = 57.0 bits (136), Expect = 1e-06 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -3 Query: 128 SEPYTHICFCFVPVLVASVLLGLTSALCQWASQVKKRTSYLM 3 S P + + VPVLVASVL GL SALCQWASQVKK +SYLM Sbjct: 172 SNPDQILFYGIVPVLVASVLSGLASALCQWASQVKKHSSYLM 213 >XP_016573206.1 PREDICTED: CMP-sialic acid transporter 5 isoform X1 [Capsicum annuum] Length = 330 Score = 57.0 bits (136), Expect = 1e-06 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -3 Query: 128 SEPYTHICFCFVPVLVASVLLGLTSALCQWASQVKKRTSYLM 3 S P + + VPVLVASVL GL SALCQWASQVKK +SYLM Sbjct: 172 SNPDQILFYGIVPVLVASVLSGLASALCQWASQVKKHSSYLM 213 >XP_015076314.1 PREDICTED: CMP-sialic acid transporter 5 [Solanum pennellii] Length = 330 Score = 57.0 bits (136), Expect = 1e-06 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -3 Query: 128 SEPYTHICFCFVPVLVASVLLGLTSALCQWASQVKKRTSYLM 3 S P + + VPVLVASVL GL SALCQWASQVKK +SYLM Sbjct: 172 SNPDEILFYGIVPVLVASVLSGLASALCQWASQVKKHSSYLM 213 >XP_004240015.1 PREDICTED: CMP-sialic acid transporter 5 [Solanum lycopersicum] Length = 330 Score = 57.0 bits (136), Expect = 1e-06 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -3 Query: 128 SEPYTHICFCFVPVLVASVLLGLTSALCQWASQVKKRTSYLM 3 S P + + VPVLVASVL GL SALCQWASQVKK +SYLM Sbjct: 172 SNPDEILFYGIVPVLVASVLSGLASALCQWASQVKKHSSYLM 213 >XP_009594352.1 PREDICTED: CMP-sialic acid transporter 5 [Nicotiana tomentosiformis] XP_016497954.1 PREDICTED: CMP-sialic acid transporter 5-like [Nicotiana tabacum] Length = 334 Score = 57.0 bits (136), Expect = 1e-06 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -3 Query: 128 SEPYTHICFCFVPVLVASVLLGLTSALCQWASQVKKRTSYLM 3 S P + + VPVLVASVL GL SALCQWASQVKK +SYLM Sbjct: 176 SNPDEILFYGIVPVLVASVLSGLASALCQWASQVKKHSSYLM 217 >KJB40375.1 hypothetical protein B456_007G060800 [Gossypium raimondii] Length = 279 Score = 56.6 bits (135), Expect = 1e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 125 EPYTHICFCFVPVLVASVLLGLTSALCQWASQVKKRTSYLM 3 +P + + VPVLVASVL GL SALCQWASQVKK +SYLM Sbjct: 170 DPEQILFYGIVPVLVASVLSGLASALCQWASQVKKHSSYLM 210 >CDP01452.1 unnamed protein product [Coffea canephora] Length = 288 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 95 VPVLVASVLLGLTSALCQWASQVKKRTSYLM 3 +PVLVASVL GL SALCQWASQVKK TSYLM Sbjct: 189 IPVLVASVLSGLASALCQWASQVKKHTSYLM 219 >KZV53752.1 hypothetical protein F511_00018 [Dorcoceras hygrometricum] Length = 919 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 95 VPVLVASVLLGLTSALCQWASQVKKRTSYLM 3 VPVLVASVL GL SALCQWASQVKK TSYLM Sbjct: 763 VPVLVASVLSGLASALCQWASQVKKHTSYLM 793 >XP_017638417.1 PREDICTED: CMP-sialic acid transporter 5-like [Gossypium arboreum] Length = 327 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 125 EPYTHICFCFVPVLVASVLLGLTSALCQWASQVKKRTSYLM 3 +P + + VPVLVASVL GL SALCQWASQVKK +SYLM Sbjct: 170 DPEQILFYGIVPVLVASVLSGLASALCQWASQVKKHSSYLM 210 >XP_016694994.1 PREDICTED: CMP-sialic acid transporter 5-like [Gossypium hirsutum] Length = 327 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 125 EPYTHICFCFVPVLVASVLLGLTSALCQWASQVKKRTSYLM 3 +P + + VPVLVASVL GL SALCQWASQVKK +SYLM Sbjct: 170 DPEQILFYGIVPVLVASVLSGLASALCQWASQVKKHSSYLM 210