BLASTX nr result
ID: Panax25_contig00024630
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00024630 (349 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017223134.1 PREDICTED: protein transport protein Sec61 subuni... 85 7e-17 KZT75834.1 hypothetical protein F511_47141, partial [Dorcoceras ... 80 9e-17 XP_017232978.1 PREDICTED: protein transport protein Sec61 subuni... 83 3e-16 XP_019154117.1 PREDICTED: protein transport protein Sec61 subuni... 83 3e-16 XP_019249469.1 PREDICTED: protein transport protein Sec61 subuni... 83 3e-16 XP_009769708.1 PREDICTED: protein transport protein Sec61 subuni... 83 3e-16 XP_009626265.1 PREDICTED: protein transport protein Sec61 subuni... 83 3e-16 XP_011098207.1 PREDICTED: protein transport protein Sec61 subuni... 82 4e-16 XP_011098204.1 PREDICTED: protein transport protein Sec61 subuni... 82 5e-16 KVH96787.1 hypothetical protein Ccrd_001121 [Cynara cardunculus ... 82 6e-16 ONL94976.1 SecY protein transport family protein [Zea mays] 81 6e-16 XP_020095787.1 protein transport protein Sec61 subunit alpha-lik... 82 6e-16 NP_001143980.1 uncharacterized protein LOC100276798 [Zea mays] A... 81 7e-16 XP_011083291.1 PREDICTED: protein transport protein Sec61 subuni... 82 9e-16 XP_019703493.1 PREDICTED: protein transport protein Sec61 subuni... 82 9e-16 XP_010930041.1 PREDICTED: protein transport protein Sec61 subuni... 82 9e-16 XP_008809619.1 PREDICTED: protein transport protein Sec61 subuni... 82 9e-16 ONL94979.1 SecY protein transport family protein [Zea mays] 81 9e-16 XP_008807199.1 PREDICTED: protein transport protein Sec61 subuni... 81 1e-15 ONM09636.1 SecY protein transport family protein [Zea mays] 81 1e-15 >XP_017223134.1 PREDICTED: protein transport protein Sec61 subunit alpha-like [Daucus carota subsp. sativus] XP_017223150.1 PREDICTED: protein transport protein Sec61 subunit alpha-like [Daucus carota subsp. sativus] KZM84602.1 hypothetical protein DCAR_027976 [Daucus carota subsp. sativus] KZM84603.1 hypothetical protein DCAR_027975 [Daucus carota subsp. sativus] Length = 475 Score = 84.7 bits (208), Expect = 7e-17 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 223 QLLYRKYTGNFLVNLLGKWQESEYLGQSVPVGGLVYYVTAPS 348 QLLYRKY+GNFLVNLLGKWQESEY GQSVPVGGL YYVTAPS Sbjct: 309 QLLYRKYSGNFLVNLLGKWQESEYSGQSVPVGGLAYYVTAPS 350 >KZT75834.1 hypothetical protein F511_47141, partial [Dorcoceras hygrometricum] Length = 136 Score = 79.7 bits (195), Expect = 9e-17 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = +1 Query: 223 QLLYRKYTGNFLVNLLGKWQESEYLGQSVPVGGLVYYVTAPS 348 QLL+R+Y+GNFLVNLLGKW+ESEY GQSVPVGGL YY+TAPS Sbjct: 94 QLLHRRYSGNFLVNLLGKWKESEYSGQSVPVGGLAYYITAPS 135 >XP_017232978.1 PREDICTED: protein transport protein Sec61 subunit alpha-like [Daucus carota subsp. sativus] KZN04312.1 hypothetical protein DCAR_005149 [Daucus carota subsp. sativus] Length = 475 Score = 83.2 bits (204), Expect = 3e-16 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +1 Query: 223 QLLYRKYTGNFLVNLLGKWQESEYLGQSVPVGGLVYYVTAPS 348 QLLYRKY+GNFLVNLLGKWQESEY GQSVPVGGL YYVT PS Sbjct: 309 QLLYRKYSGNFLVNLLGKWQESEYSGQSVPVGGLAYYVTTPS 350 >XP_019154117.1 PREDICTED: protein transport protein Sec61 subunit alpha-like [Ipomoea nil] Length = 475 Score = 82.8 bits (203), Expect = 3e-16 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +1 Query: 223 QLLYRKYTGNFLVNLLGKWQESEYLGQSVPVGGLVYYVTAPS 348 QLLYRKY+GNFLVNLLGKW+ESEY GQSVPVGGL YY+TAPS Sbjct: 309 QLLYRKYSGNFLVNLLGKWKESEYSGQSVPVGGLAYYITAPS 350 >XP_019249469.1 PREDICTED: protein transport protein Sec61 subunit alpha-like [Nicotiana attenuata] OIT00180.1 hypothetical protein A4A49_59984 [Nicotiana attenuata] Length = 475 Score = 82.8 bits (203), Expect = 3e-16 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +1 Query: 223 QLLYRKYTGNFLVNLLGKWQESEYLGQSVPVGGLVYYVTAPS 348 QLLYRKY+GNFLVNLLGKW+ESEY GQSVPVGGL YY+TAPS Sbjct: 309 QLLYRKYSGNFLVNLLGKWKESEYSGQSVPVGGLAYYITAPS 350 >XP_009769708.1 PREDICTED: protein transport protein Sec61 subunit alpha-like [Nicotiana sylvestris] XP_016511292.1 PREDICTED: protein transport protein Sec61 subunit alpha-like [Nicotiana tabacum] Length = 475 Score = 82.8 bits (203), Expect = 3e-16 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +1 Query: 223 QLLYRKYTGNFLVNLLGKWQESEYLGQSVPVGGLVYYVTAPS 348 QLLYRKY+GNFLVNLLGKW+ESEY GQSVPVGGL YY+TAPS Sbjct: 309 QLLYRKYSGNFLVNLLGKWKESEYSGQSVPVGGLAYYITAPS 350 >XP_009626265.1 PREDICTED: protein transport protein Sec61 subunit alpha-like [Nicotiana tomentosiformis] XP_009626266.1 PREDICTED: protein transport protein Sec61 subunit alpha-like [Nicotiana tomentosiformis] XP_016470202.1 PREDICTED: protein transport protein Sec61 subunit alpha-like [Nicotiana tabacum] XP_016470203.1 PREDICTED: protein transport protein Sec61 subunit alpha-like [Nicotiana tabacum] Length = 475 Score = 82.8 bits (203), Expect = 3e-16 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +1 Query: 223 QLLYRKYTGNFLVNLLGKWQESEYLGQSVPVGGLVYYVTAPS 348 QLLYRKY+GNFLVNLLGKW+ESEY GQSVPVGGL YY+TAPS Sbjct: 309 QLLYRKYSGNFLVNLLGKWKESEYSGQSVPVGGLAYYITAPS 350 >XP_011098207.1 PREDICTED: protein transport protein Sec61 subunit alpha-like isoform X2 [Sesamum indicum] XP_011098208.1 PREDICTED: protein transport protein Sec61 subunit alpha-like isoform X2 [Sesamum indicum] Length = 387 Score = 82.4 bits (202), Expect = 4e-16 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +1 Query: 223 QLLYRKYTGNFLVNLLGKWQESEYLGQSVPVGGLVYYVTAPS 348 QLLYRKY+GNFLVNLLGKW+ESEY GQS+PVGGL YY+TAPS Sbjct: 309 QLLYRKYSGNFLVNLLGKWKESEYSGQSIPVGGLAYYITAPS 350 >XP_011098204.1 PREDICTED: protein transport protein Sec61 subunit alpha-like isoform X1 [Sesamum indicum] XP_011098205.1 PREDICTED: protein transport protein Sec61 subunit alpha-like isoform X1 [Sesamum indicum] XP_011098206.1 PREDICTED: protein transport protein Sec61 subunit alpha-like isoform X1 [Sesamum indicum] Length = 475 Score = 82.4 bits (202), Expect = 5e-16 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +1 Query: 223 QLLYRKYTGNFLVNLLGKWQESEYLGQSVPVGGLVYYVTAPS 348 QLLYRKY+GNFLVNLLGKW+ESEY GQS+PVGGL YY+TAPS Sbjct: 309 QLLYRKYSGNFLVNLLGKWKESEYSGQSIPVGGLAYYITAPS 350 >KVH96787.1 hypothetical protein Ccrd_001121 [Cynara cardunculus var. scolymus] Length = 359 Score = 81.6 bits (200), Expect = 6e-16 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = +1 Query: 214 VYLQLLYRKYTGNFLVNLLGKWQESEYLGQSVPVGGLVYYVTAPS 348 V L LL+RKY+GNFLVNLLGKW+ESEY GQSVPVGGL YYVTAPS Sbjct: 190 VVLPLLHRKYSGNFLVNLLGKWKESEYSGQSVPVGGLAYYVTAPS 234 >ONL94976.1 SecY protein transport family protein [Zea mays] Length = 290 Score = 80.9 bits (198), Expect = 6e-16 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +1 Query: 223 QLLYRKYTGNFLVNLLGKWQESEYLGQSVPVGGLVYYVTAPS 348 QLLYRKY+GNFLVNLLGKW+ESEY G S+PVGGL YYVTAPS Sbjct: 171 QLLYRKYSGNFLVNLLGKWKESEYSGHSIPVGGLAYYVTAPS 212 >XP_020095787.1 protein transport protein Sec61 subunit alpha-like [Ananas comosus] XP_020095788.1 protein transport protein Sec61 subunit alpha-like [Ananas comosus] Length = 475 Score = 82.0 bits (201), Expect = 6e-16 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +1 Query: 223 QLLYRKYTGNFLVNLLGKWQESEYLGQSVPVGGLVYYVTAPS 348 QLLYRKY+GNFLVNLLGKW+ESEY GQSVPVGG+ YY+TAPS Sbjct: 309 QLLYRKYSGNFLVNLLGKWKESEYSGQSVPVGGIAYYITAPS 350 >NP_001143980.1 uncharacterized protein LOC100276798 [Zea mays] ACG36882.1 hypothetical protein [Zea mays] Length = 337 Score = 81.3 bits (199), Expect = 7e-16 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +1 Query: 223 QLLYRKYTGNFLVNLLGKWQESEYLGQSVPVGGLVYYVTAPS 348 QLLYRKY+GNFLVNLLGKW+ESEY G SVPVGGL YYVTAPS Sbjct: 171 QLLYRKYSGNFLVNLLGKWKESEYSGHSVPVGGLAYYVTAPS 212 >XP_011083291.1 PREDICTED: protein transport protein Sec61 subunit alpha-like [Sesamum indicum] Length = 451 Score = 81.6 bits (200), Expect = 9e-16 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +1 Query: 223 QLLYRKYTGNFLVNLLGKWQESEYLGQSVPVGGLVYYVTAPS 348 QLLYR+Y+GNFLVNLLGKW+ESEY GQSVPVGGL YY+TAPS Sbjct: 309 QLLYRRYSGNFLVNLLGKWKESEYSGQSVPVGGLAYYITAPS 350 >XP_019703493.1 PREDICTED: protein transport protein Sec61 subunit alpha-like [Elaeis guineensis] Length = 475 Score = 81.6 bits (200), Expect = 9e-16 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +1 Query: 223 QLLYRKYTGNFLVNLLGKWQESEYLGQSVPVGGLVYYVTAPS 348 QLLYR+Y+GNFLVNLLGKW+ESEY GQSVPVGGL YY+TAPS Sbjct: 309 QLLYRRYSGNFLVNLLGKWKESEYSGQSVPVGGLAYYITAPS 350 >XP_010930041.1 PREDICTED: protein transport protein Sec61 subunit alpha [Elaeis guineensis] Length = 475 Score = 81.6 bits (200), Expect = 9e-16 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +1 Query: 223 QLLYRKYTGNFLVNLLGKWQESEYLGQSVPVGGLVYYVTAPS 348 QLLYR+Y+GNFLVNLLGKW+ESEY GQSVPVGGL YY+TAPS Sbjct: 309 QLLYRRYSGNFLVNLLGKWKESEYSGQSVPVGGLAYYITAPS 350 >XP_008809619.1 PREDICTED: protein transport protein Sec61 subunit alpha-like [Phoenix dactylifera] XP_008809620.1 PREDICTED: protein transport protein Sec61 subunit alpha-like [Phoenix dactylifera] Length = 475 Score = 81.6 bits (200), Expect = 9e-16 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +1 Query: 223 QLLYRKYTGNFLVNLLGKWQESEYLGQSVPVGGLVYYVTAPS 348 QLLYR+Y+GNFLVNLLGKW+ESEY GQSVPVGGL YY+TAPS Sbjct: 309 QLLYRRYSGNFLVNLLGKWKESEYSGQSVPVGGLAYYITAPS 350 >ONL94979.1 SecY protein transport family protein [Zea mays] Length = 337 Score = 80.9 bits (198), Expect = 9e-16 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +1 Query: 223 QLLYRKYTGNFLVNLLGKWQESEYLGQSVPVGGLVYYVTAPS 348 QLLYRKY+GNFLVNLLGKW+ESEY G S+PVGGL YYVTAPS Sbjct: 171 QLLYRKYSGNFLVNLLGKWKESEYSGHSIPVGGLAYYVTAPS 212 >XP_008807199.1 PREDICTED: protein transport protein Sec61 subunit alpha-like [Phoenix dactylifera] Length = 397 Score = 81.3 bits (199), Expect = 1e-15 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = +1 Query: 223 QLLYRKYTGNFLVNLLGKWQESEYLGQSVPVGGLVYYVTAPS 348 QLLYR+Y+GNFLVNLLGKW+ESEY GQS+PVGGL YY+TAPS Sbjct: 231 QLLYRRYSGNFLVNLLGKWKESEYSGQSIPVGGLAYYITAPS 272 >ONM09636.1 SecY protein transport family protein [Zea mays] Length = 423 Score = 81.3 bits (199), Expect = 1e-15 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +1 Query: 223 QLLYRKYTGNFLVNLLGKWQESEYLGQSVPVGGLVYYVTAPS 348 QLLYRKY+GNFLVNLLGKW+ESEY G SVPVGGL YYVTAPS Sbjct: 257 QLLYRKYSGNFLVNLLGKWKESEYSGHSVPVGGLAYYVTAPS 298