BLASTX nr result
ID: Panax25_contig00021983
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00021983 (446 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EPS59327.1 hypothetical protein M569_15481, partial [Genlisea au... 55 1e-06 XP_017184078.1 PREDICTED: mitochondrial import receptor subunit ... 54 4e-06 >EPS59327.1 hypothetical protein M569_15481, partial [Genlisea aurea] Length = 135 Score = 54.7 bits (130), Expect = 1e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 42 LFWAGQHQKSGIGYAARYNTDKMIFISQNA 131 LFWAGQH+KSGIGYAARYNTDKM+ Q A Sbjct: 12 LFWAGQHRKSGIGYAARYNTDKMVATGQVA 41 >XP_017184078.1 PREDICTED: mitochondrial import receptor subunit TOM40-1-like [Malus domestica] Length = 153 Score = 53.5 bits (127), Expect = 4e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +3 Query: 42 LFWAGQHQKSGIGYAARYNTDKMIFISQNA 131 +FWAGQH+KSGIGYAARYNTDKM+ Q A Sbjct: 7 VFWAGQHRKSGIGYAARYNTDKMVATGQVA 36