BLASTX nr result
ID: Panax25_contig00013768
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00013768 (432 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006492336.1 PREDICTED: probable glutamyl endopeptidase, chlor... 56 3e-06 >XP_006492336.1 PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform X1 [Citrus sinensis] Length = 969 Score = 55.8 bits (133), Expect = 3e-06 Identities = 33/56 (58%), Positives = 38/56 (67%), Gaps = 4/56 (7%) Frame = +1 Query: 277 LVVSDEAAAEEVIRCGVRLIIF----GATLHRWLIPNKIVVDGNSYGAFMTANLLA 432 LV EAA EEV+R GV L+ F GA L + P+KI V G+SYGAFMTANLLA Sbjct: 739 LVACAEAAVEEVVRRGVSLLTFYNFSGAVLVQVAHPSKIAVGGHSYGAFMTANLLA 794