BLASTX nr result
ID: Panax25_contig00002104
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00002104 (554 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017228520.1 PREDICTED: ACT domain-containing protein ACR6-lik... 58 5e-07 XP_017247775.1 PREDICTED: ACT domain-containing protein ACR6 iso... 59 5e-07 XP_017247774.1 PREDICTED: ACT domain-containing protein ACR6 iso... 59 5e-07 XP_017228517.1 PREDICTED: ACT domain-containing protein ACR6-lik... 58 8e-07 KZM80613.1 hypothetical protein DCAR_032002 [Daucus carota subsp... 58 1e-06 KZM95365.1 hypothetical protein DCAR_018607 [Daucus carota subsp... 56 2e-06 XP_017251040.1 PREDICTED: LOW QUALITY PROTEIN: ACT domain-contai... 56 4e-06 >XP_017228520.1 PREDICTED: ACT domain-containing protein ACR6-like isoform X2 [Daucus carota subsp. sativus] Length = 242 Score = 58.2 bits (139), Expect = 5e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 457 QTLESDAFFVSPLRGSVGLMPSENHTSIELTG 552 +TLESD FFV+PLRGSVGLMPS+NHT+IEL G Sbjct: 24 KTLESDTFFVTPLRGSVGLMPSQNHTAIELAG 55 >XP_017247775.1 PREDICTED: ACT domain-containing protein ACR6 isoform X2 [Daucus carota subsp. sativus] KZM98144.1 hypothetical protein DCAR_014494 [Daucus carota subsp. sativus] Length = 443 Score = 58.9 bits (141), Expect = 5e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 457 QTLESDAFFVSPLRGSVGLMPSENHTSIELTG 552 +TLESD FFVSP+RGSVGLMPS+NHT+IEL G Sbjct: 92 ETLESDTFFVSPIRGSVGLMPSQNHTAIELAG 123 >XP_017247774.1 PREDICTED: ACT domain-containing protein ACR6 isoform X1 [Daucus carota subsp. sativus] Length = 446 Score = 58.9 bits (141), Expect = 5e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 457 QTLESDAFFVSPLRGSVGLMPSENHTSIELTG 552 +TLESD FFVSP+RGSVGLMPS+NHT+IEL G Sbjct: 92 ETLESDTFFVSPIRGSVGLMPSQNHTAIELAG 123 >XP_017228517.1 PREDICTED: ACT domain-containing protein ACR6-like isoform X1 [Daucus carota subsp. sativus] XP_017228518.1 PREDICTED: ACT domain-containing protein ACR6-like isoform X1 [Daucus carota subsp. sativus] XP_017228519.1 PREDICTED: ACT domain-containing protein ACR6-like isoform X1 [Daucus carota subsp. sativus] Length = 324 Score = 58.2 bits (139), Expect = 8e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 457 QTLESDAFFVSPLRGSVGLMPSENHTSIELTG 552 +TLESD FFV+PLRGSVGLMPS+NHT+IEL G Sbjct: 106 KTLESDTFFVTPLRGSVGLMPSQNHTAIELAG 137 >KZM80613.1 hypothetical protein DCAR_032002 [Daucus carota subsp. sativus] Length = 458 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 460 TLESDAFFVSPLRGSVGLMPSENHTSIELTG 552 TLESD FFV+PLRGSVGLMPS+NHT+IEL G Sbjct: 139 TLESDTFFVTPLRGSVGLMPSQNHTAIELAG 169 >KZM95365.1 hypothetical protein DCAR_018607 [Daucus carota subsp. sativus] Length = 191 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 457 QTLESDAFFVSPLRGSVGLMPSENHTSIELTG 552 +TLESD FFVS LRGSVGLMPS+NHT+IEL G Sbjct: 90 ETLESDTFFVSHLRGSVGLMPSQNHTAIELAG 121 >XP_017251040.1 PREDICTED: LOW QUALITY PROTEIN: ACT domain-containing protein ACR6-like [Daucus carota subsp. sativus] Length = 356 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 457 QTLESDAFFVSPLRGSVGLMPSENHTSIELTG 552 +TLESD FFVS LRGSVGLMPS+NHT+IEL G Sbjct: 150 ETLESDTFFVSHLRGSVGLMPSQNHTAIELAG 181