BLASTX nr result
ID: Panax24_contig00037720
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00037720 (351 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017215699.1 PREDICTED: uncharacterized membrane protein At3g2... 64 1e-09 XP_018809951.1 PREDICTED: uncharacterized membrane protein At3g2... 60 4e-08 XP_019185513.1 PREDICTED: uncharacterized membrane protein At3g2... 59 7e-08 XP_002277444.1 PREDICTED: uncharacterized membrane protein At3g2... 57 3e-07 XP_007047226.2 PREDICTED: uncharacterized membrane protein At3g2... 56 8e-07 EOX91383.1 Uncharacterized protein TCM_000596 [Theobroma cacao] 56 8e-07 XP_017977547.1 PREDICTED: uncharacterized membrane protein At3g2... 56 8e-07 XP_011099151.1 PREDICTED: uncharacterized membrane protein At3g2... 56 1e-06 KVH92535.1 hypothetical protein Ccrd_005422 [Cynara cardunculus ... 55 2e-06 OAY35456.1 hypothetical protein MANES_12G103000 [Manihot esculenta] 55 3e-06 XP_010275588.1 PREDICTED: uncharacterized membrane protein At3g2... 55 3e-06 XP_010275587.1 PREDICTED: uncharacterized membrane protein At3g2... 55 3e-06 XP_012855447.1 PREDICTED: uncharacterized membrane protein At3g2... 54 4e-06 GAV80687.1 hypothetical protein CFOL_v3_24147 [Cephalotus follic... 54 5e-06 CDP02487.1 unnamed protein product [Coffea canephora] 54 7e-06 XP_016476435.1 PREDICTED: uncharacterized membrane protein At3g2... 54 7e-06 XP_009594241.1 PREDICTED: uncharacterized membrane protein At3g2... 54 7e-06 XP_009803082.1 PREDICTED: uncharacterized membrane protein At3g2... 53 1e-05 >XP_017215699.1 PREDICTED: uncharacterized membrane protein At3g27390 [Daucus carota subsp. sativus] KZM88653.1 hypothetical protein DCAR_025728 [Daucus carota subsp. sativus] Length = 575 Score = 64.3 bits (155), Expect = 1e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 108 MPRTIKDWLRIIYVLFSFCAALCLGALKSVLVGPIA 1 +P TI+DWLRIIYV+FSF AALCLGA+KSVLVGP+A Sbjct: 2 LPSTIEDWLRIIYVVFSFFAALCLGAVKSVLVGPVA 37 >XP_018809951.1 PREDICTED: uncharacterized membrane protein At3g27390 [Juglans regia] XP_018809952.1 PREDICTED: uncharacterized membrane protein At3g27390 [Juglans regia] XP_018809953.1 PREDICTED: uncharacterized membrane protein At3g27390 [Juglans regia] XP_018809954.1 PREDICTED: uncharacterized membrane protein At3g27390 [Juglans regia] Length = 563 Score = 60.1 bits (144), Expect = 4e-08 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = -1 Query: 111 NMPRTIKDWLRIIYVLFSFCAALCLGALKSVLVGPIA 1 ++P + DWLRI+YV+F+FC+ALCLGALK +LVGPIA Sbjct: 2 DLPASRSDWLRILYVVFAFCSALCLGALKGLLVGPIA 38 >XP_019185513.1 PREDICTED: uncharacterized membrane protein At3g27390-like [Ipomoea nil] XP_019185514.1 PREDICTED: uncharacterized membrane protein At3g27390-like [Ipomoea nil] Length = 580 Score = 59.3 bits (142), Expect = 7e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -1 Query: 108 MPRTIKDWLRIIYVLFSFCAALCLGALKSVLVGPIA 1 M +++DWL +YV+FSFCAALCLGALKS+LVGPIA Sbjct: 1 MSNSLQDWLTGVYVVFSFCAALCLGALKSLLVGPIA 36 >XP_002277444.1 PREDICTED: uncharacterized membrane protein At3g27390 [Vitis vinifera] XP_010652816.1 PREDICTED: uncharacterized membrane protein At3g27390 [Vitis vinifera] XP_010652817.1 PREDICTED: uncharacterized membrane protein At3g27390 [Vitis vinifera] CBI21438.3 unnamed protein product, partial [Vitis vinifera] Length = 559 Score = 57.4 bits (137), Expect = 3e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -1 Query: 108 MPRTIKDWLRIIYVLFSFCAALCLGALKSVLVGPIA 1 M T+KDWL+I+YV+F+FC+A LGALK +LVGPIA Sbjct: 1 MESTLKDWLKIVYVIFAFCSAFSLGALKGMLVGPIA 36 >XP_007047226.2 PREDICTED: uncharacterized membrane protein At3g27390 isoform X2 [Theobroma cacao] Length = 575 Score = 56.2 bits (134), Expect = 8e-07 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -1 Query: 102 RTIKDWLRIIYVLFSFCAALCLGALKSVLVGPIA 1 RT WL+I+YV+F+FC+ALCLGALK +LVGPIA Sbjct: 17 RTQAGWLKIVYVVFAFCSALCLGALKGLLVGPIA 50 >EOX91383.1 Uncharacterized protein TCM_000596 [Theobroma cacao] Length = 575 Score = 56.2 bits (134), Expect = 8e-07 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -1 Query: 102 RTIKDWLRIIYVLFSFCAALCLGALKSVLVGPIA 1 RT WL+I+YV+F+FC+ALCLGALK +LVGPIA Sbjct: 17 RTQAGWLKIVYVVFAFCSALCLGALKGLLVGPIA 50 >XP_017977547.1 PREDICTED: uncharacterized membrane protein At3g27390 isoform X1 [Theobroma cacao] Length = 580 Score = 56.2 bits (134), Expect = 8e-07 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -1 Query: 102 RTIKDWLRIIYVLFSFCAALCLGALKSVLVGPIA 1 RT WL+I+YV+F+FC+ALCLGALK +LVGPIA Sbjct: 17 RTQAGWLKIVYVVFAFCSALCLGALKGLLVGPIA 50 >XP_011099151.1 PREDICTED: uncharacterized membrane protein At3g27390 [Sesamum indicum] Length = 591 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -1 Query: 108 MPRTIKDWLRIIYVLFSFCAALCLGALKSVLVGPIA 1 M R++KDW+ IYV+ +FC+ LC GALKS+LVGPIA Sbjct: 1 MSRSLKDWVETIYVVLAFCSVLCFGALKSLLVGPIA 36 >KVH92535.1 hypothetical protein Ccrd_005422 [Cynara cardunculus var. scolymus] Length = 548 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -1 Query: 108 MPRTIKDWLRIIYVLFSFCAALCLGALKSVLVGPIA 1 M + DWL+IIYV+F+FC+AL GALKSVLVGPIA Sbjct: 1 MLNVLPDWLKIIYVVFAFCSALFFGALKSVLVGPIA 36 >OAY35456.1 hypothetical protein MANES_12G103000 [Manihot esculenta] Length = 566 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -1 Query: 108 MPRTIKDWLRIIYVLFSFCAALCLGALKSVLVGPIA 1 M ++ WLRI+YV+F+FC+AL LGALK+VLVGPIA Sbjct: 3 MSNNLQGWLRILYVVFAFCSALFLGALKAVLVGPIA 38 >XP_010275588.1 PREDICTED: uncharacterized membrane protein At3g27390-like isoform X2 [Nelumbo nucifera] Length = 566 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -1 Query: 108 MPRTIKDWLRIIYVLFSFCAALCLGALKSVLVGPIA 1 M ++K WL IIYV+F+FC+AL LGALK +LVGP+A Sbjct: 1 MSNSLKQWLNIIYVVFAFCSALFLGALKGILVGPVA 36 >XP_010275587.1 PREDICTED: uncharacterized membrane protein At3g27390-like isoform X1 [Nelumbo nucifera] Length = 594 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -1 Query: 108 MPRTIKDWLRIIYVLFSFCAALCLGALKSVLVGPIA 1 M ++K WL IIYV+F+FC+AL LGALK +LVGP+A Sbjct: 1 MSNSLKQWLNIIYVVFAFCSALFLGALKGILVGPVA 36 >XP_012855447.1 PREDICTED: uncharacterized membrane protein At3g27390 [Erythranthe guttata] EYU44387.1 hypothetical protein MIMGU_mgv1a018905mg [Erythranthe guttata] Length = 585 Score = 54.3 bits (129), Expect = 4e-06 Identities = 21/36 (58%), Positives = 30/36 (83%) Frame = -1 Query: 108 MPRTIKDWLRIIYVLFSFCAALCLGALKSVLVGPIA 1 M ++KDW++ YV+F+FC+ LC GA+KS+LVGPIA Sbjct: 1 MASSLKDWVKAFYVVFAFCSVLCFGAIKSLLVGPIA 36 >GAV80687.1 hypothetical protein CFOL_v3_24147 [Cephalotus follicularis] Length = 565 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -1 Query: 108 MPRTIKDWLRIIYVLFSFCAALCLGALKSVLVGPIA 1 MP + WL+I+YV+F+FC+AL LGALK +LVGPIA Sbjct: 1 MPDNLSGWLKILYVVFAFCSALFLGALKGLLVGPIA 36 >CDP02487.1 unnamed protein product [Coffea canephora] Length = 580 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -1 Query: 96 IKDWLRIIYVLFSFCAALCLGALKSVLVGPIA 1 +KD LR +YV+F+FC+ALCLG LKS+LVGPIA Sbjct: 6 LKDCLRTLYVIFAFCSALCLGGLKSLLVGPIA 37 >XP_016476435.1 PREDICTED: uncharacterized membrane protein At3g27390-like [Nicotiana tabacum] Length = 591 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -1 Query: 108 MPRTIKDWLRIIYVLFSFCAALCLGALKSVLVGPIA 1 M +++WL +YV+F+FC+AL LGALKSVLVGPIA Sbjct: 1 MSNNVENWLNAVYVVFAFCSALFLGALKSVLVGPIA 36 >XP_009594241.1 PREDICTED: uncharacterized membrane protein At3g27390 [Nicotiana tomentosiformis] Length = 591 Score = 53.5 bits (127), Expect = 7e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -1 Query: 108 MPRTIKDWLRIIYVLFSFCAALCLGALKSVLVGPIA 1 M +++WL +YV+F+FC+AL LGALKSVLVGPIA Sbjct: 1 MSNNVENWLNAVYVVFAFCSALFLGALKSVLVGPIA 36 >XP_009803082.1 PREDICTED: uncharacterized membrane protein At3g27390 [Nicotiana sylvestris] XP_016479477.1 PREDICTED: uncharacterized membrane protein At3g27390-like [Nicotiana tabacum] Length = 591 Score = 53.1 bits (126), Expect = 1e-05 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = -1 Query: 108 MPRTIKDWLRIIYVLFSFCAALCLGALKSVLVGPIA 1 M + +WL +YV+F+FC+AL LGALKSVLVGPIA Sbjct: 1 MSNNVDNWLNAVYVVFAFCSALLLGALKSVLVGPIA 36