BLASTX nr result
ID: Panax24_contig00020046
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00020046 (467 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017259055.1 PREDICTED: uncharacterized protein LOC108228085 i... 60 9e-08 XP_017259054.1 PREDICTED: uncharacterized protein LOC108228085 i... 60 9e-08 >XP_017259055.1 PREDICTED: uncharacterized protein LOC108228085 isoform X2 [Daucus carota subsp. sativus] XP_017259057.1 PREDICTED: uncharacterized protein LOC108228085 isoform X2 [Daucus carota subsp. sativus] KZM90877.1 hypothetical protein DCAR_021758 [Daucus carota subsp. sativus] Length = 665 Score = 60.5 bits (145), Expect = 9e-08 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = -2 Query: 466 ASCSNQTVDDGTPNVLHKPAFVYKRPLINQICFGASGSRR 347 ASCSN + D TPNVLHKPAF +KRPLINQICF R Sbjct: 615 ASCSNSVLGDETPNVLHKPAFAHKRPLINQICFRGKPQHR 654 >XP_017259054.1 PREDICTED: uncharacterized protein LOC108228085 isoform X1 [Daucus carota subsp. sativus] Length = 702 Score = 60.5 bits (145), Expect = 9e-08 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = -2 Query: 466 ASCSNQTVDDGTPNVLHKPAFVYKRPLINQICFGASGSRR 347 ASCSN + D TPNVLHKPAF +KRPLINQICF R Sbjct: 652 ASCSNSVLGDETPNVLHKPAFAHKRPLINQICFRGKPQHR 691