BLASTX nr result
ID: Panax24_contig00014106
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00014106 (653 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017634359.1 PREDICTED: luc7-like protein 3 isoform X1 [Gossyp... 52 8e-09 XP_017182154.1 PREDICTED: luc7-like protein 3 [Malus domestica] 56 1e-06 XP_017185898.1 PREDICTED: luc7-like protein 3 [Malus domestica] 56 2e-06 KQL23497.1 hypothetical protein SETIT_030327mg [Setaria italica] 56 6e-06 ONM21039.1 LUC7 N_terminus domain-containing protein [Zea mays] 56 6e-06 ONM21038.1 LUC7 N_terminus domain-containing protein [Zea mays] 56 7e-06 XP_013683322.1 PREDICTED: luc7-like protein 3 [Brassica napus] 56 7e-06 XP_010555615.1 PREDICTED: luc7-like protein 3 [Tarenaya hassleri... 56 7e-06 XP_018476227.1 PREDICTED: luc7-like protein 3 [Raphanus sativus]... 56 7e-06 XP_013629785.1 PREDICTED: luc7-like protein 3 [Brassica oleracea... 56 7e-06 XP_009132608.1 PREDICTED: luc7-like protein 3 [Brassica rapa] XP... 56 7e-06 CDY32631.1 BnaC03g15990D [Brassica napus] 56 7e-06 CDY38861.1 BnaA03g13180D [Brassica napus] 56 7e-06 XP_006401981.1 hypothetical protein EUTSA_v10014057mg [Eutrema s... 56 7e-06 NP_001131813.1 LUC7 N_terminus domain-containing protein [Zea ma... 56 8e-06 XP_004956127.1 PREDICTED: luc7-like protein 3 [Setaria italica] ... 56 8e-06 ONM21035.1 LUC7 N_terminus domain-containing protein [Zea mays] 56 8e-06 AAB68042.1 putative aspartate-arginine-rich mRNA binding protein... 54 8e-06 >XP_017634359.1 PREDICTED: luc7-like protein 3 isoform X1 [Gossypium arboreum] Length = 354 Score = 52.0 bits (123), Expect(2) = 8e-09 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = +1 Query: 1 DAIERTQSHVTGKQHIGYGMVRDFLA 78 DA ERTQSHVTGKQHIGYG+VRDF++ Sbjct: 206 DAAERTQSHVTGKQHIGYGLVRDFIS 231 Score = 35.8 bits (81), Expect(2) = 8e-09 Identities = 39/102 (38%), Positives = 46/102 (45%) Frame = +2 Query: 170 NMRVDVEEAIQVTGIRTVXXXXXXXXXXXXXXXXXXXVKGLERDMVEEAVMGEEGWIGSI 349 NMRV EAIQV G + KGLE M E VM E IG Sbjct: 261 NMRVG-GEAIQVIGTNIMIERRTETDIGNVIWI----AKGLESGMGEVFVM--ERGIGGT 313 Query: 350 TILEMEEREAEIDTVSVIGAGRVPLLGVDAGGHPEVQFAHIT 475 + EME A IDT + AG +P + + AGG EVQF I+ Sbjct: 314 GMAEME---AGIDTGNA--AGPIPPVDIVAGGPQEVQFTDIS 350 >XP_017182154.1 PREDICTED: luc7-like protein 3 [Malus domestica] Length = 130 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 1 DAIERTQSHVTGKQHIGYGMVRDFLA 78 DA+ERTQSHVTGKQHIGYGMVRDF+A Sbjct: 22 DAVERTQSHVTGKQHIGYGMVRDFIA 47 >XP_017185898.1 PREDICTED: luc7-like protein 3 [Malus domestica] Length = 139 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 1 DAIERTQSHVTGKQHIGYGMVRDFLA 78 DA+ERTQSHVTGKQHIGYGMVRDF+A Sbjct: 68 DAVERTQSHVTGKQHIGYGMVRDFIA 93 >KQL23497.1 hypothetical protein SETIT_030327mg [Setaria italica] Length = 285 Score = 56.2 bits (134), Expect = 6e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +1 Query: 1 DAIERTQSHVTGKQHIGYGMVRDFLA 78 DA+ERTQSHVTGKQHIGYGMVRDFLA Sbjct: 134 DALERTQSHVTGKQHIGYGMVRDFLA 159 >ONM21039.1 LUC7 N_terminus domain-containing protein [Zea mays] Length = 289 Score = 56.2 bits (134), Expect = 6e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +1 Query: 1 DAIERTQSHVTGKQHIGYGMVRDFLA 78 DA+ERTQSHVTGKQHIGYGMVRDFLA Sbjct: 138 DALERTQSHVTGKQHIGYGMVRDFLA 163 >ONM21038.1 LUC7 N_terminus domain-containing protein [Zea mays] Length = 304 Score = 56.2 bits (134), Expect = 7e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +1 Query: 1 DAIERTQSHVTGKQHIGYGMVRDFLA 78 DA+ERTQSHVTGKQHIGYGMVRDFLA Sbjct: 153 DALERTQSHVTGKQHIGYGMVRDFLA 178 >XP_013683322.1 PREDICTED: luc7-like protein 3 [Brassica napus] Length = 321 Score = 56.2 bits (134), Expect = 7e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 1 DAIERTQSHVTGKQHIGYGMVRDFLA 78 DA+ERTQSHVTGKQH+GYGMVRDFLA Sbjct: 205 DAVERTQSHVTGKQHVGYGMVRDFLA 230 >XP_010555615.1 PREDICTED: luc7-like protein 3 [Tarenaya hassleriana] Length = 326 Score = 56.2 bits (134), Expect = 7e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 1 DAIERTQSHVTGKQHIGYGMVRDFLA 78 DA+ERTQSHVTGKQH+GYGMVRDFLA Sbjct: 205 DAVERTQSHVTGKQHVGYGMVRDFLA 230 >XP_018476227.1 PREDICTED: luc7-like protein 3 [Raphanus sativus] XP_018476228.1 PREDICTED: luc7-like protein 3 [Raphanus sativus] Length = 332 Score = 56.2 bits (134), Expect = 7e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 1 DAIERTQSHVTGKQHIGYGMVRDFLA 78 DA+ERTQSHVTGKQH+GYGMVRDFLA Sbjct: 205 DAVERTQSHVTGKQHVGYGMVRDFLA 230 >XP_013629785.1 PREDICTED: luc7-like protein 3 [Brassica oleracea var. oleracea] Length = 335 Score = 56.2 bits (134), Expect = 7e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 1 DAIERTQSHVTGKQHIGYGMVRDFLA 78 DA+ERTQSHVTGKQH+GYGMVRDFLA Sbjct: 205 DAVERTQSHVTGKQHVGYGMVRDFLA 230 >XP_009132608.1 PREDICTED: luc7-like protein 3 [Brassica rapa] XP_013640541.1 PREDICTED: luc7-like protein 3 [Brassica napus] Length = 335 Score = 56.2 bits (134), Expect = 7e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 1 DAIERTQSHVTGKQHIGYGMVRDFLA 78 DA+ERTQSHVTGKQH+GYGMVRDFLA Sbjct: 205 DAVERTQSHVTGKQHVGYGMVRDFLA 230 >CDY32631.1 BnaC03g15990D [Brassica napus] Length = 335 Score = 56.2 bits (134), Expect = 7e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 1 DAIERTQSHVTGKQHIGYGMVRDFLA 78 DA+ERTQSHVTGKQH+GYGMVRDFLA Sbjct: 205 DAVERTQSHVTGKQHVGYGMVRDFLA 230 >CDY38861.1 BnaA03g13180D [Brassica napus] Length = 335 Score = 56.2 bits (134), Expect = 7e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 1 DAIERTQSHVTGKQHIGYGMVRDFLA 78 DA+ERTQSHVTGKQH+GYGMVRDFLA Sbjct: 205 DAVERTQSHVTGKQHVGYGMVRDFLA 230 >XP_006401981.1 hypothetical protein EUTSA_v10014057mg [Eutrema salsugineum] XP_006401982.1 hypothetical protein EUTSA_v10014057mg [Eutrema salsugineum] ESQ43434.1 hypothetical protein EUTSA_v10014057mg [Eutrema salsugineum] ESQ43435.1 hypothetical protein EUTSA_v10014057mg [Eutrema salsugineum] Length = 335 Score = 56.2 bits (134), Expect = 7e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 1 DAIERTQSHVTGKQHIGYGMVRDFLA 78 DA+ERTQSHVTGKQH+GYGMVRDFLA Sbjct: 205 DAVERTQSHVTGKQHVGYGMVRDFLA 230 >NP_001131813.1 LUC7 N_terminus domain-containing protein [Zea mays] ACF80389.1 unknown [Zea mays] ONM21034.1 LUC7 N_terminus domain-containing protein [Zea mays] ONM21036.1 LUC7 N_terminus domain-containing protein [Zea mays] ONM21037.1 LUC7 N_terminus domain-containing protein [Zea mays] Length = 352 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +1 Query: 1 DAIERTQSHVTGKQHIGYGMVRDFLA 78 DA+ERTQSHVTGKQHIGYGMVRDFLA Sbjct: 201 DALERTQSHVTGKQHIGYGMVRDFLA 226 >XP_004956127.1 PREDICTED: luc7-like protein 3 [Setaria italica] XP_004956128.1 PREDICTED: luc7-like protein 3 [Setaria italica] KQL23498.1 hypothetical protein SETIT_030327mg [Setaria italica] KQL23499.1 hypothetical protein SETIT_030327mg [Setaria italica] Length = 352 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +1 Query: 1 DAIERTQSHVTGKQHIGYGMVRDFLA 78 DA+ERTQSHVTGKQHIGYGMVRDFLA Sbjct: 201 DALERTQSHVTGKQHIGYGMVRDFLA 226 >ONM21035.1 LUC7 N_terminus domain-containing protein [Zea mays] Length = 357 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +1 Query: 1 DAIERTQSHVTGKQHIGYGMVRDFLA 78 DA+ERTQSHVTGKQHIGYGMVRDFLA Sbjct: 206 DALERTQSHVTGKQHIGYGMVRDFLA 231 >AAB68042.1 putative aspartate-arginine-rich mRNA binding protein, partial [Arabidopsis thaliana] Length = 156 Score = 54.3 bits (129), Expect = 8e-06 Identities = 22/26 (84%), Positives = 26/26 (100%) Frame = +1 Query: 1 DAIERTQSHVTGKQHIGYGMVRDFLA 78 DA+ERTQSHVTGKQH+GYG+VRDF+A Sbjct: 27 DAVERTQSHVTGKQHVGYGLVRDFIA 52