BLASTX nr result
ID: Panax24_contig00011996
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax24_contig00011996 (479 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONK57678.1 uncharacterized protein A4U43_C09F2950 [Asparagus off... 55 4e-07 ONK64340.1 uncharacterized protein A4U43_C07F24680 [Asparagus of... 56 2e-06 >ONK57678.1 uncharacterized protein A4U43_C09F2950 [Asparagus officinalis] Length = 111 Score = 55.5 bits (132), Expect = 4e-07 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 1/44 (2%) Frame = -3 Query: 198 CGQFAICKITRSNKNGNEGRIYYACPNGKCG-FLGKCKAINEEK 70 CG+ A KIT+SNKN N GRIYY+C KCG FLG CK + E+ Sbjct: 26 CGELADMKITKSNKNNNRGRIYYSCKRQKCGSFLGWCKISSIEQ 69 >ONK64340.1 uncharacterized protein A4U43_C07F24680 [Asparagus officinalis] Length = 227 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/49 (55%), Positives = 32/49 (65%), Gaps = 1/49 (2%) Frame = -3 Query: 198 CGQFAICKITRSNKNGNEGRIYYACPNGKCG-FLGKCKAINEEKSSATI 55 CG+ A KIT+SNKN N GRIYY+C KCG FLG CK + E+ I Sbjct: 66 CGELADVKITKSNKNNNRGRIYYSCKRQKCGSFLGWCKISSIEQKPFVI 114