BLASTX nr result
ID: Panax21_contig00038087
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00038087 (399 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADD30265.1| ribosomal protein L23 [Oxalis latifolia] gi|34080... 179 2e-43 ref|YP_087008.1| ribosomal protein L23 [Panax ginseng] gi|522208... 179 3e-43 gb|ABV59095.2| ribosomal protein L23 [Mangifera indica] 178 4e-43 ref|YP_740160.1| ribosomal protein L23 [Daucus carota] gi|114107... 177 6e-43 ref|YP_001718479.1| ribosomal protein L23 [Manihot esculenta] gi... 177 8e-43 >gb|ADD30265.1| ribosomal protein L23 [Oxalis latifolia] gi|340806831|gb|AEK71474.1| ribosomal protein L23 [Eucryphia lucida] gi|340807131|gb|AEK71729.1| ribosomal protein L23 [Oxalis latifolia] Length = 93 Score = 179 bits (455), Expect = 2e-43 Identities = 86/93 (92%), Positives = 89/93 (95%) Frame = +1 Query: 79 MDGIKYVVFTDKSIRLLGKNQYTSNVESGSTRTEIKHWVELFFGIKVIAMNSHQLLGRGR 258 MDGIKY VFTDKSIRLLGKNQYTSNVESGSTRTEIKHWVELFFG+KVIAMNSH+LLG+GR Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYTSNVESGSTRTEIKHWVELFFGVKVIAMNSHRLLGKGR 60 Query: 259 RMRPIMGETMHYRHMIITLQPGYSIPPLRKKRT 357 RM PIMG TMHYR MIITLQPGYSIPPLRKKRT Sbjct: 61 RMGPIMGHTMHYRRMIITLQPGYSIPPLRKKRT 93 >ref|YP_087008.1| ribosomal protein L23 [Panax ginseng] gi|52220875|ref|YP_087029.1| ribosomal protein L23 [Panax ginseng] gi|359422187|ref|YP_004935595.1| ribosomal protein L23 (chloroplast) [Eleutherococcus senticosus] gi|359422206|ref|YP_004935616.1| ribosomal protein L23 (chloroplast) [Eleutherococcus senticosus] gi|75289348|sp|Q68RU3.1|RK23_PANGI RecName: Full=50S ribosomal protein L23, chloroplastic gi|51235355|gb|AAT98551.1| ribosomal protein L23 [Panax ginseng] gi|51235378|gb|AAT98574.1| ribosomal protein L23 [Panax ginseng] gi|347448250|gb|AEO92662.1| ribosomal protein L23 (chloroplast) [Eleutherococcus senticosus] gi|347448269|gb|AEO92681.1| ribosomal protein L23 (chloroplast) [Eleutherococcus senticosus] Length = 93 Score = 179 bits (453), Expect = 3e-43 Identities = 86/93 (92%), Positives = 89/93 (95%) Frame = +1 Query: 79 MDGIKYVVFTDKSIRLLGKNQYTSNVESGSTRTEIKHWVELFFGIKVIAMNSHQLLGRGR 258 MDGIKY VFTDKSIRLLGKNQYTSNVESGSTRTEIKHWVELFFG+KVIAMNSH+L GRGR Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYTSNVESGSTRTEIKHWVELFFGVKVIAMNSHRLPGRGR 60 Query: 259 RMRPIMGETMHYRHMIITLQPGYSIPPLRKKRT 357 RM PIMG+TMHYR MIITLQPGYSIPPLRKKRT Sbjct: 61 RMGPIMGQTMHYRRMIITLQPGYSIPPLRKKRT 93 >gb|ABV59095.2| ribosomal protein L23 [Mangifera indica] Length = 93 Score = 178 bits (452), Expect = 4e-43 Identities = 86/93 (92%), Positives = 88/93 (94%) Frame = +1 Query: 79 MDGIKYVVFTDKSIRLLGKNQYTSNVESGSTRTEIKHWVELFFGIKVIAMNSHQLLGRGR 258 MDGIKY VFTDKSIRLLGKNQYTSNVESGSTRTEIKHWVELFFG+KVIAMNSHQL G+GR Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYTSNVESGSTRTEIKHWVELFFGVKVIAMNSHQLPGKGR 60 Query: 259 RMRPIMGETMHYRHMIITLQPGYSIPPLRKKRT 357 RM PIMG TMHYR MIITLQPGYSIPPLRKKRT Sbjct: 61 RMGPIMGHTMHYRRMIITLQPGYSIPPLRKKRT 93 >ref|YP_740160.1| ribosomal protein L23 [Daucus carota] gi|114107196|ref|YP_740179.1| ribosomal protein L23 [Daucus carota] gi|323149125|ref|YP_004222689.1| ribosomal protein L23 [Anthriscus cerefolium] gi|323149145|ref|YP_004222708.1| ribosomal protein L23 [Anthriscus cerefolium] gi|122246290|sp|Q0G9Q0.1|RK23_DAUCA RecName: Full=50S ribosomal protein L23, chloroplastic gi|113200950|gb|ABI32466.1| ribosomal protein L23 [Daucus carota] gi|113200971|gb|ABI32487.1| ribosomal protein L23 [Daucus carota] gi|156582751|gb|ABU85207.1| ribosomal protein L23 [Anethum graveolens] gi|289645618|gb|ADD13681.1| ribosomal protein L23 [Anthriscus cerefolium] gi|289645638|gb|ADD13701.1| ribosomal protein L23 [Anthriscus cerefolium] Length = 93 Score = 177 bits (450), Expect = 6e-43 Identities = 85/93 (91%), Positives = 89/93 (95%) Frame = +1 Query: 79 MDGIKYVVFTDKSIRLLGKNQYTSNVESGSTRTEIKHWVELFFGIKVIAMNSHQLLGRGR 258 MDGIKY VFTDKSIRLLGKNQYTSNVESGSTRTEIKHWVELFFG+KVIAMNSH+L G+GR Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYTSNVESGSTRTEIKHWVELFFGVKVIAMNSHRLPGKGR 60 Query: 259 RMRPIMGETMHYRHMIITLQPGYSIPPLRKKRT 357 RM PIMG+TMHYR MIITLQPGYSIPPLRKKRT Sbjct: 61 RMGPIMGQTMHYRRMIITLQPGYSIPPLRKKRT 93 >ref|YP_001718479.1| ribosomal protein L23 [Manihot esculenta] gi|169794134|ref|YP_001718497.1| ribosomal protein L23 [Manihot esculenta] gi|225544165|ref|YP_002720154.1| rpl23 [Jatropha curcas] gi|225544185|ref|YP_002720175.1| rpl23 [Jatropha curcas] gi|372450182|ref|YP_005090220.1| rpl23 gene product (chloroplast) [Ricinus communis] gi|372450202|ref|YP_005090240.1| rpl23 gene product (chloroplast) [Ricinus communis] gi|157695927|gb|ABV66196.1| ribosomal protein L23 [Manihot esculenta] gi|157695946|gb|ABV66215.1| ribosomal protein L23 [Manihot esculenta] gi|224979606|gb|ACN72733.1| rpl23 [Jatropha curcas] gi|224979626|gb|ACN72753.1| rpl23 [Jatropha curcas] gi|339516208|gb|AEJ82598.1| ribosomal protein L23 [Ricinus communis] gi|339516228|gb|AEJ82618.1| ribosomal protein L23 [Ricinus communis] Length = 93 Score = 177 bits (449), Expect = 8e-43 Identities = 85/93 (91%), Positives = 88/93 (94%) Frame = +1 Query: 79 MDGIKYVVFTDKSIRLLGKNQYTSNVESGSTRTEIKHWVELFFGIKVIAMNSHQLLGRGR 258 MDGIKY VFTDKSIRLLGKNQYT NVESGSTRTEIKHWVELFFG+KVIAMNSH+L G+GR Sbjct: 1 MDGIKYAVFTDKSIRLLGKNQYTFNVESGSTRTEIKHWVELFFGVKVIAMNSHRLPGKGR 60 Query: 259 RMRPIMGETMHYRHMIITLQPGYSIPPLRKKRT 357 RMRPIMG TMHYR MIITLQPGYSIPPLRKKRT Sbjct: 61 RMRPIMGHTMHYRRMIITLQPGYSIPPLRKKRT 93