BLASTX nr result
ID: Panax21_contig00036392
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00036392 (415 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004135307.1| PREDICTED: OTU domain-containing protein At3... 124 8e-27 ref|XP_002514949.1| OTU domain-containing protein 6B, putative [... 121 5e-26 ref|XP_003537539.1| PREDICTED: OTU domain-containing protein At3... 118 4e-25 tpg|DAA47952.1| TPA: OTU-like cysteine protease family protein i... 114 6e-24 ref|XP_002445909.1| hypothetical protein SORBIDRAFT_07g027850 [S... 114 6e-24 >ref|XP_004135307.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] gi|449494889|ref|XP_004159675.1| PREDICTED: OTU domain-containing protein At3g57810-like [Cucumis sativus] Length = 145 Score = 124 bits (311), Expect = 8e-27 Identities = 54/71 (76%), Positives = 64/71 (90%) Frame = -3 Query: 413 YVTHMRQPHVWGGEPELLMASHVLQMPINVCILDSKSGSLRIIAEYGQGYGKENPIHVLY 234 YV HMRQPHVWGGEPELLM+SHVLQMPI+V + D KSG+L++IAEYGQ YGKENPI VL+ Sbjct: 72 YVRHMRQPHVWGGEPELLMSSHVLQMPISVYMCDKKSGNLKVIAEYGQEYGKENPIRVLF 131 Query: 233 HGYGHYDALRS 201 H YGHYD+L++ Sbjct: 132 HSYGHYDSLKA 142 >ref|XP_002514949.1| OTU domain-containing protein 6B, putative [Ricinus communis] gi|223546000|gb|EEF47503.1| OTU domain-containing protein 6B, putative [Ricinus communis] Length = 167 Score = 121 bits (304), Expect = 5e-26 Identities = 55/73 (75%), Positives = 64/73 (87%) Frame = -3 Query: 413 YVTHMRQPHVWGGEPELLMASHVLQMPINVCILDSKSGSLRIIAEYGQGYGKENPIHVLY 234 YV MRQPHVWGGEPELLM+SHVL++PI V + D SGSL++IAEYGQ YGKENPI VLY Sbjct: 88 YVGQMRQPHVWGGEPELLMSSHVLKIPITVYMRDRNSGSLKVIAEYGQEYGKENPICVLY 147 Query: 233 HGYGHYDALRSQS 195 HGYGHYDAL++Q+ Sbjct: 148 HGYGHYDALQNQT 160 >ref|XP_003537539.1| PREDICTED: OTU domain-containing protein At3g57810-like [Glycine max] Length = 156 Score = 118 bits (296), Expect = 4e-25 Identities = 51/74 (68%), Positives = 60/74 (81%) Frame = -3 Query: 413 YVTHMRQPHVWGGEPELLMASHVLQMPINVCILDSKSGSLRIIAEYGQGYGKENPIHVLY 234 Y MR+PH+WGGEPELLM+SHVLQMPI V + D S +L++IAEYGQ YGK+NPI V+Y Sbjct: 82 YTVQMRKPHIWGGEPELLMSSHVLQMPITVLMQDKSSSNLKVIAEYGQEYGKDNPIRVIY 141 Query: 233 HGYGHYDALRSQSF 192 HGYGHYDAL SF Sbjct: 142 HGYGHYDALLKSSF 155 >tpg|DAA47952.1| TPA: OTU-like cysteine protease family protein isoform 1 [Zea mays] gi|414869396|tpg|DAA47953.1| TPA: OTU-like cysteine protease family protein isoform 2 [Zea mays] gi|414869397|tpg|DAA47954.1| TPA: OTU-like cysteine protease family protein isoform 3 [Zea mays] Length = 223 Score = 114 bits (286), Expect = 6e-24 Identities = 51/70 (72%), Positives = 59/70 (84%) Frame = -3 Query: 413 YVTHMRQPHVWGGEPELLMASHVLQMPINVCILDSKSGSLRIIAEYGQGYGKENPIHVLY 234 YV+H+R+PHVWGGEPEL MASHVLQMPI V + D +G L IAEYGQ YGKE+PI VLY Sbjct: 143 YVSHIREPHVWGGEPELFMASHVLQMPITVYMRDEDAGGLIAIAEYGQQYGKEDPIQVLY 202 Query: 233 HGYGHYDALR 204 HG+GHYDAL+ Sbjct: 203 HGFGHYDALQ 212 >ref|XP_002445909.1| hypothetical protein SORBIDRAFT_07g027850 [Sorghum bicolor] gi|241942259|gb|EES15404.1| hypothetical protein SORBIDRAFT_07g027850 [Sorghum bicolor] Length = 309 Score = 114 bits (286), Expect = 6e-24 Identities = 51/70 (72%), Positives = 59/70 (84%) Frame = -3 Query: 413 YVTHMRQPHVWGGEPELLMASHVLQMPINVCILDSKSGSLRIIAEYGQGYGKENPIHVLY 234 YV+H+R+PHVWGGEPEL MASHVLQMPI V + D +G L IAEYGQ YGKE+PI VLY Sbjct: 229 YVSHIREPHVWGGEPELFMASHVLQMPITVYMRDEDAGGLIAIAEYGQQYGKEDPIQVLY 288 Query: 233 HGYGHYDALR 204 HG+GHYDAL+ Sbjct: 289 HGFGHYDALQ 298