BLASTX nr result
ID: Panax21_contig00035788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00035788 (367 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA74120.1| putative [Nicotiana tabacum] 86 3e-15 gb|EEC71383.1| hypothetical protein OsI_03499 [Oryza sativa Indi... 86 4e-15 ref|XP_004139780.1| PREDICTED: ras-related protein Rab7-like [Cu... 84 9e-15 gb|AFU92144.1| small GTP binding protein [Arachis hypogaea] 84 9e-15 ref|XP_003556176.1| PREDICTED: ras-related protein Rab7-like [Gl... 84 9e-15 >gb|AAA74120.1| putative [Nicotiana tabacum] Length = 204 Score = 85.9 bits (211), Expect = 3e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +1 Query: 244 RYVHKKFSQQYKATIGADFVTKELQIDDRIVTLQIWDTAGQ 366 RYVHKKFSQQYKATIGADFVTKELQIDDR+VTLQIWDTAGQ Sbjct: 27 RYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQIWDTAGQ 67 >gb|EEC71383.1| hypothetical protein OsI_03499 [Oryza sativa Indica Group] Length = 288 Score = 85.5 bits (210), Expect = 4e-15 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = +1 Query: 226 VCNSLCRYVHKKFSQQYKATIGADFVTKELQIDDRIVTLQIWDTAGQ 366 +C +L RYVHKKFSQQYKATIGADFVTKE+ I+DR+VTLQIWDTAGQ Sbjct: 37 ICLTLVRYVHKKFSQQYKATIGADFVTKEVLIEDRLVTLQIWDTAGQ 83 >ref|XP_004139780.1| PREDICTED: ras-related protein Rab7-like [Cucumis sativus] gi|449502892|ref|XP_004161772.1| PREDICTED: ras-related protein Rab7-like [Cucumis sativus] Length = 205 Score = 84.3 bits (207), Expect = 9e-15 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +1 Query: 244 RYVHKKFSQQYKATIGADFVTKELQIDDRIVTLQIWDTAGQ 366 +YVHKKFSQQYKATIGADFVTKELQIDDR+VTLQIWDTAGQ Sbjct: 27 QYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQIWDTAGQ 67 >gb|AFU92144.1| small GTP binding protein [Arachis hypogaea] Length = 205 Score = 84.3 bits (207), Expect = 9e-15 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +1 Query: 244 RYVHKKFSQQYKATIGADFVTKELQIDDRIVTLQIWDTAGQ 366 +YVHKKFSQQYKATIGADFVTKELQIDDR+VTLQIWDTAGQ Sbjct: 27 QYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQIWDTAGQ 67 >ref|XP_003556176.1| PREDICTED: ras-related protein Rab7-like [Glycine max] gi|3914559|sp|Q43463.1|RAB7_SOYBN RecName: Full=Ras-related protein Rab7 gi|414834|gb|AAA34004.1| Rab7p [Glycine max] Length = 206 Score = 84.3 bits (207), Expect = 9e-15 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +1 Query: 244 RYVHKKFSQQYKATIGADFVTKELQIDDRIVTLQIWDTAGQ 366 +YVHKKFSQQYKATIGADFVTKELQIDDR+VTLQIWDTAGQ Sbjct: 27 QYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQIWDTAGQ 67