BLASTX nr result
ID: Panax21_contig00034000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00034000 (718 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABV25015.1| beta-galactosidase a-peptide [Cloning vector pTri... 79 1e-12 >gb|ABV25015.1| beta-galactosidase a-peptide [Cloning vector pTriplEx2] Length = 127 Score = 78.6 bits (192), Expect = 1e-12 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -2 Query: 120 AASAQSTLDSSKLMHAAAIRAHLANSPYSESYYNSLAVVL 1 AASAQSTLDSSKLMHAAAIRAHLANSPYSESYYNSLAVVL Sbjct: 39 AASAQSTLDSSKLMHAAAIRAHLANSPYSESYYNSLAVVL 78