BLASTX nr result
ID: Panax21_contig00029616
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00029616 (377 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI37171.3| unnamed protein product [Vitis vinifera] 72 5e-11 ref|XP_002273521.1| PREDICTED: cellulose synthase A catalytic su... 72 5e-11 gb|AAY60844.1| cellulose synthase 2 [Eucalyptus grandis] 71 8e-11 ref|XP_003533679.1| PREDICTED: cellulose synthase A catalytic su... 71 8e-11 ref|XP_003532664.1| PREDICTED: cellulose synthase A catalytic su... 71 8e-11 >emb|CBI37171.3| unnamed protein product [Vitis vinifera] Length = 1000 Score = 72.0 bits (175), Expect = 5e-11 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGSVTEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 691 IGWIYGSVTEDILTGFKMHCRGWKSVYCMPKRAAFKGSAPINLSDRLHQVLRW 743 >ref|XP_002273521.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like [Vitis vinifera] Length = 1044 Score = 72.0 bits (175), Expect = 5e-11 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGSVTEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 735 IGWIYGSVTEDILTGFKMHCRGWKSVYCMPKRAAFKGSAPINLSDRLHQVLRW 787 >gb|AAY60844.1| cellulose synthase 2 [Eucalyptus grandis] Length = 1045 Score = 71.2 bits (173), Expect = 8e-11 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGSVTEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 736 IGWIYGSVTEDILTGFKMHCRGWKSVYCMPKRPAFKGSAPINLSDRLHQVLRW 788 >ref|XP_003533679.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like [Glycine max] Length = 1050 Score = 71.2 bits (173), Expect = 8e-11 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGSVTEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 741 IGWIYGSVTEDILTGFKMHCRGWKSVYCMPKRPAFKGSAPINLSDRLHQVLRW 793 >ref|XP_003532664.1| PREDICTED: cellulose synthase A catalytic subunit 4 [UDP-forming]-like [Glycine max] Length = 1034 Score = 71.2 bits (173), Expect = 8e-11 Identities = 35/53 (66%), Positives = 37/53 (69%) Frame = -3 Query: 375 IG*IYGSVTEDILTGFKIHCRGWKSVYCMPKDLLIHGSQISSHLVTLSTCLRW 217 IG IYGSVTEDILTGFK+HCRGWKSVYCMPK GS + L LRW Sbjct: 725 IGWIYGSVTEDILTGFKMHCRGWKSVYCMPKRPAFKGSAPINLSDRLHQVLRW 777