BLASTX nr result
ID: Panax21_contig00029051
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00029051 (403 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511505.1| pentatricopeptide repeat-containing protein,... 150 1e-34 ref|XP_002321537.1| predicted protein [Populus trichocarpa] gi|2... 150 1e-34 ref|XP_002887557.1| pentatricopeptide repeat-containing protein ... 148 4e-34 ref|XP_002890305.1| pentatricopeptide repeat-containing protein ... 148 5e-34 ref|NP_177613.1| pentatricopeptide repeat-containing protein [Ar... 145 4e-33 >ref|XP_002511505.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550620|gb|EEF52107.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 876 Score = 150 bits (378), Expect = 1e-34 Identities = 70/80 (87%), Positives = 76/80 (95%) Frame = -3 Query: 401 FRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFVG 222 FR+QML+SGI PSRIDIVTGWGRRSRVTGSSMVRQ+VQELL++F FPFFTENGNSGCFVG Sbjct: 797 FRQQMLVSGISPSRIDIVTGWGRRSRVTGSSMVRQAVQELLHIFSFPFFTENGNSGCFVG 856 Query: 221 CGETLNRWLLQSYVERMHLL 162 CGE LNRWLLQ YV+RMHLL Sbjct: 857 CGEPLNRWLLQPYVDRMHLL 876 >ref|XP_002321537.1| predicted protein [Populus trichocarpa] gi|222868533|gb|EEF05664.1| predicted protein [Populus trichocarpa] Length = 834 Score = 150 bits (378), Expect = 1e-34 Identities = 69/80 (86%), Positives = 77/80 (96%) Frame = -3 Query: 401 FRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFVG 222 FRRQML+SG+ PSRIDIVTGWGRRSRVTGSS+VRQ+VQELL++F FPFFTENGN+GCFVG Sbjct: 755 FRRQMLVSGVIPSRIDIVTGWGRRSRVTGSSLVRQAVQELLHIFSFPFFTENGNTGCFVG 814 Query: 221 CGETLNRWLLQSYVERMHLL 162 CGE L+RWLLQSYVERMHLL Sbjct: 815 CGEPLSRWLLQSYVERMHLL 834 >ref|XP_002887557.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297333398|gb|EFH63816.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 845 Score = 148 bits (374), Expect = 4e-34 Identities = 67/80 (83%), Positives = 76/80 (95%) Frame = -3 Query: 401 FRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFVG 222 FR+QML++G CPSRIDIVTGWGRRSRVTG+SMVRQ+V+ELLN+F FPFFTENGNSGCFVG Sbjct: 766 FRKQMLVTGDCPSRIDIVTGWGRRSRVTGTSMVRQAVEELLNIFNFPFFTENGNSGCFVG 825 Query: 221 CGETLNRWLLQSYVERMHLL 162 CGE L +WLL+SYVERMHLL Sbjct: 826 CGEPLKKWLLESYVERMHLL 845 >ref|XP_002890305.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297336147|gb|EFH66564.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 860 Score = 148 bits (373), Expect = 5e-34 Identities = 68/80 (85%), Positives = 77/80 (96%) Frame = -3 Query: 401 FRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFVG 222 FRRQML+SG CPSRIDIVTGWGRRSRVTG+SMVRQ+V+ELLN+F PFFTE+GNSGCFVG Sbjct: 781 FRRQMLVSGTCPSRIDIVTGWGRRSRVTGTSMVRQAVEELLNIFGSPFFTESGNSGCFVG 840 Query: 221 CGETLNRWLLQSYVERMHLL 162 CGE+LN+WLLQS+VERMHLL Sbjct: 841 CGESLNKWLLQSHVERMHLL 860 >ref|NP_177613.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75207514|sp|Q9SSF9.1|PP123_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g74750 gi|5882748|gb|AAD55301.1|AC008263_32 Contains 2 PF|01535 DUF domains [Arabidopsis thaliana] gi|332197508|gb|AEE35629.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 855 Score = 145 bits (365), Expect = 4e-33 Identities = 67/80 (83%), Positives = 74/80 (92%) Frame = -3 Query: 401 FRRQMLMSGICPSRIDIVTGWGRRSRVTGSSMVRQSVQELLNMFQFPFFTENGNSGCFVG 222 FR+QML+SG CPSRIDIVTGWGRRSRVTG+SMVRQ+V+ELLN+F FPFFTENGNSGCFVG Sbjct: 776 FRKQMLVSGDCPSRIDIVTGWGRRSRVTGTSMVRQAVEELLNIFNFPFFTENGNSGCFVG 835 Query: 221 CGETLNRWLLQSYVERMHLL 162 GE L WLL+SYVERMHLL Sbjct: 836 SGEPLKNWLLESYVERMHLL 855