BLASTX nr result
ID: Panax21_contig00027750
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00027750 (439 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588402.1| hypothetical protein MTR_1g006860 [Medicago ... 57 5e-08 >ref|XP_003588402.1| hypothetical protein MTR_1g006860 [Medicago truncatula] gi|355477450|gb|AES58653.1| hypothetical protein MTR_1g006860 [Medicago truncatula] Length = 57 Score = 56.6 bits (135), Expect(2) = 5e-08 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +2 Query: 5 IVSWVRIPFPPARK*NGRAKLRERKNLLVESSPP 106 +V WVRIPFPPARK NGRAKLRERKNLLV P Sbjct: 17 VVVWVRIPFPPARKWNGRAKLRERKNLLVLVESP 50 Score = 25.4 bits (54), Expect(2) = 5e-08 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +1 Query: 94 VQSPGGQNSTT 126 V+SPGGQNSTT Sbjct: 47 VESPGGQNSTT 57