BLASTX nr result
ID: Panax21_contig00027600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00027600 (502 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_01682799.1| fatty oxidation complex alpha subunit [Vibrio... 54 1e-05 >ref|ZP_01682799.1| fatty oxidation complex alpha subunit [Vibrio cholerae V52] gi|121627762|gb|EAX60388.1| fatty oxidation complex alpha subunit [Vibrio cholerae V52] Length = 275 Score = 54.3 bits (129), Expect = 1e-05 Identities = 28/52 (53%), Positives = 32/52 (61%), Gaps = 3/52 (5%) Frame = +2 Query: 353 KIQSLMDKF---KKRRTGVILGEKSELDKYLSEDVEEADESFDILVWWKANS 499 K SL KF K++ LG KSELD+YL ED E E FDIL+WWK NS Sbjct: 152 KTNSLRTKFYMKKQKEDSGSLGVKSELDRYLLEDQEPESEDFDILIWWKVNS 203