BLASTX nr result
ID: Panax21_contig00027530
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00027530 (485 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512851.1| conserved hypothetical protein [Ricinus comm... 95 7e-18 emb|CBI21285.3| unnamed protein product [Vitis vinifera] 94 1e-17 ref|XP_002275711.1| PREDICTED: transcription factor ICE1 isoform... 94 1e-17 ref|NP_001241268.1| transcription factor ICE1-like [Glycine max]... 93 2e-17 gb|ACJ39216.1| inducer of CBF expression 6 [Glycine max] 93 2e-17 >ref|XP_002512851.1| conserved hypothetical protein [Ricinus communis] gi|223547862|gb|EEF49354.1| conserved hypothetical protein [Ricinus communis] Length = 428 Score = 94.7 bits (234), Expect = 7e-18 Identities = 46/48 (95%), Positives = 46/48 (95%) Frame = -3 Query: 441 DIQQAVISCFNGFALDVFRAEQCREGQDVLPEQIKAVLLDSAGFQGAM 298 DIQQAVISCFNGFALDVFRAEQCREGQDVLPEQIKAVLLDSAGF G M Sbjct: 381 DIQQAVISCFNGFALDVFRAEQCREGQDVLPEQIKAVLLDSAGFHGLM 428 >emb|CBI21285.3| unnamed protein product [Vitis vinifera] Length = 340 Score = 93.6 bits (231), Expect = 1e-17 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = -3 Query: 441 DIQQAVISCFNGFALDVFRAEQCREGQDVLPEQIKAVLLDSAGFQGAM 298 DIQQAVISCFNGFALDVFRAEQCREGQDVLPEQIKAVLLDSAGF G + Sbjct: 293 DIQQAVISCFNGFALDVFRAEQCREGQDVLPEQIKAVLLDSAGFHGML 340 >ref|XP_002275711.1| PREDICTED: transcription factor ICE1 isoform 1 [Vitis vinifera] Length = 538 Score = 93.6 bits (231), Expect = 1e-17 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = -3 Query: 441 DIQQAVISCFNGFALDVFRAEQCREGQDVLPEQIKAVLLDSAGFQGAM 298 DIQQAVISCFNGFALDVFRAEQCREGQDVLPEQIKAVLLDSAGF G + Sbjct: 491 DIQQAVISCFNGFALDVFRAEQCREGQDVLPEQIKAVLLDSAGFHGML 538 >ref|NP_001241268.1| transcription factor ICE1-like [Glycine max] gi|318056131|gb|ADV36252.1| ICEa [Glycine max] Length = 450 Score = 93.2 bits (230), Expect = 2e-17 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = -3 Query: 441 DIQQAVISCFNGFALDVFRAEQCREGQDVLPEQIKAVLLDSAGFQGAM 298 D+QQAVISCFNGFALDVF+AEQCREGQDVLPEQIKAVLLDSAGF G M Sbjct: 403 DVQQAVISCFNGFALDVFKAEQCREGQDVLPEQIKAVLLDSAGFHGMM 450 >gb|ACJ39216.1| inducer of CBF expression 6 [Glycine max] Length = 160 Score = 93.2 bits (230), Expect = 2e-17 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = -3 Query: 441 DIQQAVISCFNGFALDVFRAEQCREGQDVLPEQIKAVLLDSAGFQGAM 298 D+QQAVISCFNGFALDVF+AEQCREGQDVLPEQIKAVLLDSAGF G M Sbjct: 113 DVQQAVISCFNGFALDVFKAEQCREGQDVLPEQIKAVLLDSAGFHGMM 160