BLASTX nr result
ID: Panax21_contig00023288
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00023288 (436 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003533074.1| PREDICTED: uncharacterized protein LOC100805... 59 5e-07 gb|AAN62354.1|AF506028_23 CTV.22 [Citrus trifoliata] 58 7e-07 ref|XP_003604338.1| hypothetical protein MTR_4g009740 [Medicago ... 57 2e-06 ref|XP_002530460.1| transcription cofactor, putative [Ricinus co... 55 8e-06 >ref|XP_003533074.1| PREDICTED: uncharacterized protein LOC100805336 [Glycine max] Length = 1304 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/41 (70%), Positives = 30/41 (73%) Frame = -2 Query: 123 VKSGAFHQHHSSGQRSAYHHQQLKSGSQFLTSSPQLLQPAS 1 VKSG F QH +SGQ S Y HQQLK GS F SSPQLLQ AS Sbjct: 854 VKSGVFQQHLTSGQHSTYSHQQLKQGSAFPVSSPQLLQAAS 894 >gb|AAN62354.1|AF506028_23 CTV.22 [Citrus trifoliata] Length = 1405 Score = 58.2 bits (139), Expect = 7e-07 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = -2 Query: 123 VKSGAFHQHHSSGQRSAYHHQQLKSGSQFLTSSPQLLQPAS 1 VK G F QH +SGQRSAY HQ LK G+QF SSPQLLQ AS Sbjct: 955 VKPGVFQQHLTSGQRSAYSHQPLKPGAQFPISSPQLLQTAS 995 >ref|XP_003604338.1| hypothetical protein MTR_4g009740 [Medicago truncatula] gi|355505393|gb|AES86535.1| hypothetical protein MTR_4g009740 [Medicago truncatula] Length = 1290 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = -2 Query: 123 VKSGAFHQHHSSGQRSAYHHQQLKSGSQFLTSSPQLLQPAS 1 VKSG F QH +SGQ S Y HQQ+K GS F SSPQL Q AS Sbjct: 839 VKSGVFQQHLTSGQNSTYSHQQMKQGSPFQVSSPQLFQAAS 879 >ref|XP_002530460.1| transcription cofactor, putative [Ricinus communis] gi|223530005|gb|EEF31930.1| transcription cofactor, putative [Ricinus communis] Length = 1382 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = -2 Query: 123 VKSGAFHQHHSSGQRSAYHHQQLKSGSQFLTSSPQLLQPAS 1 VK G F QH S+GQR+ Y HQQ+K G+ F SSPQLLQ AS Sbjct: 932 VKPGVFQQHLSAGQRTTYPHQQMKPGASFPISSPQLLQAAS 972