BLASTX nr result
ID: Panax21_contig00023191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00023191 (446 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004144777.1| PREDICTED: uncharacterized protein LOC101210... 42 3e-06 >ref|XP_004144777.1| PREDICTED: uncharacterized protein LOC101210613 [Cucumis sativus] Length = 126 Score = 41.6 bits (96), Expect(2) = 3e-06 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +2 Query: 164 EGPFGFVEGLHRKLTRRQLGLDPGALVLLMTYEI 265 E P GF EG R+ TRRQ +DPGAL+LL T EI Sbjct: 93 ENPSGFEEGRSRRYTRRQPMVDPGALLLLTTCEI 126 Score = 34.3 bits (77), Expect(2) = 3e-06 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 5/38 (13%) Frame = +1 Query: 7 KESDGANA-----NATENPVRVTRSIVILKPPTLGDQN 105 KE DG A +++E+PVR+TRSI+I++PP G QN Sbjct: 39 KELDGGRARSYGEDSSESPVRITRSIMIVRPP--GYQN 74