BLASTX nr result
ID: Panax21_contig00018750
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00018750 (583 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002312150.1| predicted protein [Populus trichocarpa] gi|2... 79 7e-13 ref|XP_002269271.1| PREDICTED: pleckstrin homology domain-contai... 79 7e-13 ref|XP_002441190.1| hypothetical protein SORBIDRAFT_09g021960 [S... 77 2e-12 gb|EEE63903.1| hypothetical protein OsJ_18728 [Oryza sativa Japo... 77 2e-12 gb|EEC79313.1| hypothetical protein OsI_20149 [Oryza sativa Indi... 77 2e-12 >ref|XP_002312150.1| predicted protein [Populus trichocarpa] gi|222851970|gb|EEE89517.1| predicted protein [Populus trichocarpa] Length = 144 Score = 78.6 bits (192), Expect = 7e-13 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -1 Query: 583 MYFIADSEKEKEDWINSIGRSIVQHSLSVTDKEVVDYDSRK 461 MYFIADSEKEKEDWINSIGRSIVQHS SVTD E+VDYDS++ Sbjct: 104 MYFIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR 144 >ref|XP_002269271.1| PREDICTED: pleckstrin homology domain-containing protein 1 [Vitis vinifera] Length = 143 Score = 78.6 bits (192), Expect = 7e-13 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -1 Query: 583 MYFIADSEKEKEDWINSIGRSIVQHSLSVTDKEVVDYDSRK 461 MYFIADSEKEKEDWINSIGRSIVQHS SVTD E+VDYDS++ Sbjct: 103 MYFIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR 143 >ref|XP_002441190.1| hypothetical protein SORBIDRAFT_09g021960 [Sorghum bicolor] gi|241946475|gb|EES19620.1| hypothetical protein SORBIDRAFT_09g021960 [Sorghum bicolor] Length = 169 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -1 Query: 583 MYFIADSEKEKEDWINSIGRSIVQHSLSVTDKEVVDYDSR 464 MYFIADSEKEKE+WINSIGRSIVQHS SVTD EVVDYDSR Sbjct: 113 MYFIADSEKEKEEWINSIGRSIVQHSRSVTDAEVVDYDSR 152 >gb|EEE63903.1| hypothetical protein OsJ_18728 [Oryza sativa Japonica Group] Length = 151 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -1 Query: 583 MYFIADSEKEKEDWINSIGRSIVQHSLSVTDKEVVDYDSR 464 MYFIADSEKEKE+WINSIGRSIVQHS SVTD EVVDYDSR Sbjct: 93 MYFIADSEKEKEEWINSIGRSIVQHSRSVTDAEVVDYDSR 132 >gb|EEC79313.1| hypothetical protein OsI_20149 [Oryza sativa Indica Group] Length = 172 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -1 Query: 583 MYFIADSEKEKEDWINSIGRSIVQHSLSVTDKEVVDYDSR 464 MYFIADSEKEKE+WINSIGRSIVQHS SVTD EVVDYDSR Sbjct: 114 MYFIADSEKEKEEWINSIGRSIVQHSRSVTDAEVVDYDSR 153