BLASTX nr result
ID: Panax21_contig00013524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00013524 (1048 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32803.3| unnamed protein product [Vitis vinifera] 105 2e-20 ref|XP_003516891.1| PREDICTED: mitotic-spindle organizing protei... 102 2e-19 ref|XP_003520913.1| PREDICTED: mitotic-spindle organizing protei... 102 2e-19 ref|XP_002532107.1| conserved hypothetical protein [Ricinus comm... 102 2e-19 ref|XP_002283004.1| PREDICTED: mitotic-spindle organizing protei... 99 2e-18 >emb|CBI32803.3| unnamed protein product [Vitis vinifera] Length = 107 Score = 105 bits (261), Expect = 2e-20 Identities = 53/64 (82%), Positives = 57/64 (89%) Frame = +3 Query: 855 KERRVFQRLRMDPEAARTARESLDLAFVMSNILDTGLDRHTLSVLIALCDLGLNPEALAA 1034 K R FQ + MDPEAA+TARESL+LAF MSNILDTGLDRHTLSVLI LCDLGLNPEALAA Sbjct: 25 KNRNPFQSICMDPEAAQTARESLELAFHMSNILDTGLDRHTLSVLITLCDLGLNPEALAA 84 Query: 1035 VIKE 1046 V+KE Sbjct: 85 VVKE 88 >ref|XP_003516891.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Glycine max] Length = 74 Score = 102 bits (253), Expect = 2e-19 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = +3 Query: 885 MDPEAARTARESLDLAFVMSNILDTGLDRHTLSVLIALCDLGLNPEALAAVIKE 1046 MDPEAARTARESLDLAF MSNILDTGLDRHTLSVLIALCDLG+NPEALAAV+KE Sbjct: 1 MDPEAARTARESLDLAFHMSNILDTGLDRHTLSVLIALCDLGVNPEALAAVVKE 54 >ref|XP_003520913.1| PREDICTED: mitotic-spindle organizing protein 1B [Glycine max] gi|255633504|gb|ACU17110.1| unknown [Glycine max] Length = 73 Score = 102 bits (253), Expect = 2e-19 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = +3 Query: 885 MDPEAARTARESLDLAFVMSNILDTGLDRHTLSVLIALCDLGLNPEALAAVIKE 1046 MDPEAARTARESLDLAF MSNILDTGLDRHTLSVLIALCDLG+NPEALAAV+KE Sbjct: 1 MDPEAARTARESLDLAFHMSNILDTGLDRHTLSVLIALCDLGVNPEALAAVVKE 54 >ref|XP_002532107.1| conserved hypothetical protein [Ricinus communis] gi|223528210|gb|EEF30269.1| conserved hypothetical protein [Ricinus communis] Length = 74 Score = 102 bits (253), Expect = 2e-19 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = +3 Query: 885 MDPEAARTARESLDLAFVMSNILDTGLDRHTLSVLIALCDLGLNPEALAAVIKE 1046 MDPEAA+TARESLDLAF MSNILDTGLDRHTLSVLIALCDLGLNPEALAAV+KE Sbjct: 1 MDPEAAKTARESLDLAFHMSNILDTGLDRHTLSVLIALCDLGLNPEALAAVVKE 54 >ref|XP_002283004.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Vitis vinifera] Length = 73 Score = 98.6 bits (244), Expect = 2e-18 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = +3 Query: 885 MDPEAARTARESLDLAFVMSNILDTGLDRHTLSVLIALCDLGLNPEALAAVIKE 1046 MDPEAA+TARESL+LAF MSNILDTGLDRHTLSVLI LCDLGLNPEALAAV+KE Sbjct: 1 MDPEAAQTARESLELAFHMSNILDTGLDRHTLSVLITLCDLGLNPEALAAVVKE 54