BLASTX nr result
ID: Panax21_contig00011815
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00011815 (740 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532856.1| pentatricopeptide repeat-containing protein,... 60 5e-07 ref|XP_004143204.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 ref|XP_002314181.1| predicted protein [Populus trichocarpa] gi|2... 57 5e-06 >ref|XP_002532856.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527393|gb|EEF29534.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 521 Score = 60.1 bits (144), Expect = 5e-07 Identities = 23/49 (46%), Positives = 36/49 (73%) Frame = +3 Query: 405 RLWKVQPEKKKPRAIVGEFEKLPIGEPVGSALQSWMSDGFPIHRSDIFH 551 ++ + + +++ P+++ EKLP GEP+G A QSWM +GFPIHR D+FH Sbjct: 41 KILEPEEQEENPKSLSLRIEKLPRGEPIGLAFQSWMREGFPIHRGDVFH 89 >ref|XP_004143204.1| PREDICTED: pentatricopeptide repeat-containing protein At1g07590, mitochondrial-like [Cucumis sativus] gi|449517541|ref|XP_004165804.1| PREDICTED: pentatricopeptide repeat-containing protein At1g07590, mitochondrial-like [Cucumis sativus] Length = 527 Score = 56.6 bits (135), Expect = 5e-06 Identities = 26/60 (43%), Positives = 38/60 (63%) Frame = +3 Query: 372 ISTSVPKQLIARLWKVQPEKKKPRAIVGEFEKLPIGEPVGSALQSWMSDGFPIHRSDIFH 551 + T +P L + ++ E ++P+ + E++P GE VG A +SWM DGFPIHR DIFH Sbjct: 37 LCTQIPGNLSPNV--LESELEEPKCLSLRIERIPKGELVGYAFRSWMGDGFPIHRGDIFH 94 >ref|XP_002314181.1| predicted protein [Populus trichocarpa] gi|222850589|gb|EEE88136.1| predicted protein [Populus trichocarpa] Length = 525 Score = 56.6 bits (135), Expect = 5e-06 Identities = 23/38 (60%), Positives = 27/38 (71%) Frame = +3 Query: 438 PRAIVGEFEKLPIGEPVGSALQSWMSDGFPIHRSDIFH 551 P+ + EKLP GE VG A QSWM +GFPIHR D+FH Sbjct: 56 PKCLSSRIEKLPRGESVGYAFQSWMGEGFPIHRGDVFH 93