BLASTX nr result
ID: Panax21_contig00010671
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00010671 (356 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004163978.1| PREDICTED: regulator of nonsense transcripts... 97 1e-18 ref|XP_004150168.1| PREDICTED: LOW QUALITY PROTEIN: regulator of... 97 1e-18 ref|XP_003539131.1| PREDICTED: regulator of nonsense transcripts... 97 1e-18 ref|XP_003517385.1| PREDICTED: regulator of nonsense transcripts... 97 1e-18 ref|XP_003611424.1| Regulator of nonsense transcripts-like prote... 97 1e-18 >ref|XP_004163978.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Cucumis sativus] Length = 1268 Score = 97.1 bits (240), Expect = 1e-18 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +2 Query: 56 EVLVCTPSNVAVDQLAEKISATGLKVLRLCAKSREAVSSPVEHLTLHYQEEELD 217 +VLVC PSNVAVDQLAEKISATGLKV+RLCAKSREAVSSPVEHLTLHYQ LD Sbjct: 528 QVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHLTLHYQVRHLD 581 >ref|XP_004150168.1| PREDICTED: LOW QUALITY PROTEIN: regulator of nonsense transcripts 1 homolog [Cucumis sativus] Length = 1246 Score = 97.1 bits (240), Expect = 1e-18 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +2 Query: 56 EVLVCTPSNVAVDQLAEKISATGLKVLRLCAKSREAVSSPVEHLTLHYQEEELD 217 +VLVC PSNVAVDQLAEKISATGLKV+RLCAKSREAVSSPVEHLTLHYQ LD Sbjct: 528 QVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHLTLHYQVRHLD 581 >ref|XP_003539131.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Glycine max] Length = 1270 Score = 97.1 bits (240), Expect = 1e-18 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +2 Query: 56 EVLVCTPSNVAVDQLAEKISATGLKVLRLCAKSREAVSSPVEHLTLHYQEEELD 217 +VLVC PSNVAVDQLAEKISATGLKV+RLCAKSREAVSSPVEHLTLHYQ LD Sbjct: 531 QVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHLTLHYQVRHLD 584 >ref|XP_003517385.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Glycine max] Length = 1266 Score = 97.1 bits (240), Expect = 1e-18 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +2 Query: 56 EVLVCTPSNVAVDQLAEKISATGLKVLRLCAKSREAVSSPVEHLTLHYQEEELD 217 +VLVC PSNVAVDQLAEKISATGLKV+RLCAKSREAVSSPVEHLTLHYQ LD Sbjct: 528 QVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHLTLHYQVRHLD 581 >ref|XP_003611424.1| Regulator of nonsense transcripts-like protein [Medicago truncatula] gi|355512759|gb|AES94382.1| Regulator of nonsense transcripts-like protein [Medicago truncatula] Length = 1253 Score = 97.1 bits (240), Expect = 1e-18 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +2 Query: 56 EVLVCTPSNVAVDQLAEKISATGLKVLRLCAKSREAVSSPVEHLTLHYQEEELD 217 +VLVC PSNVAVDQLAEKISATGLKV+RLCAKSREAVSSPVEHLTLHYQ LD Sbjct: 522 QVLVCAPSNVAVDQLAEKISATGLKVVRLCAKSREAVSSPVEHLTLHYQVRHLD 575