BLASTX nr result
ID: Panax21_contig00010233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00010233 (708 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516399.1| protein transport protein sec23, putative [R... 65 4e-18 ref|XP_002268633.2| PREDICTED: protein transport protein SEC23-l... 64 3e-17 emb|CBI39378.3| unnamed protein product [Vitis vinifera] 64 3e-17 ref|XP_002885585.1| hypothetical protein ARALYDRAFT_479878 [Arab... 61 6e-17 ref|NP_189008.1| protein transport protein SEC23 [Arabidopsis th... 61 6e-17 >ref|XP_002516399.1| protein transport protein sec23, putative [Ricinus communis] gi|223544497|gb|EEF46016.1| protein transport protein sec23, putative [Ricinus communis] Length = 782 Score = 65.1 bits (157), Expect(2) = 4e-18 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 430 YRKDDPSSFTLNPCFSLFLQLIFNLRRSQFVQI 528 YRKDDPSSFTLNPCFSLF Q +FNLRRSQFVQ+ Sbjct: 580 YRKDDPSSFTLNPCFSLFPQFMFNLRRSQFVQV 612 Score = 52.4 bits (124), Expect(2) = 4e-18 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +2 Query: 359 QEGFDATRWLDRNLIRLCSKFGD 427 +EGFDATRWLDRNLIRLCSKFGD Sbjct: 557 EEGFDATRWLDRNLIRLCSKFGD 579 >ref|XP_002268633.2| PREDICTED: protein transport protein SEC23-like [Vitis vinifera] Length = 785 Score = 63.9 bits (154), Expect(2) = 3e-17 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 430 YRKDDPSSFTLNPCFSLFLQLIFNLRRSQFVQI 528 YRKDDP+SFTLNPCFSLF Q +FNLRRSQFVQ+ Sbjct: 583 YRKDDPASFTLNPCFSLFPQFMFNLRRSQFVQV 615 Score = 50.4 bits (119), Expect(2) = 3e-17 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = +2 Query: 359 QEGFDATRWLDRNLIRLCSKFGD 427 +EGFDATRWLDR+LIRLCSKFGD Sbjct: 560 EEGFDATRWLDRSLIRLCSKFGD 582 >emb|CBI39378.3| unnamed protein product [Vitis vinifera] Length = 707 Score = 63.9 bits (154), Expect(2) = 3e-17 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 430 YRKDDPSSFTLNPCFSLFLQLIFNLRRSQFVQI 528 YRKDDP+SFTLNPCFSLF Q +FNLRRSQFVQ+ Sbjct: 505 YRKDDPASFTLNPCFSLFPQFMFNLRRSQFVQV 537 Score = 50.4 bits (119), Expect(2) = 3e-17 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = +2 Query: 359 QEGFDATRWLDRNLIRLCSKFGD 427 +EGFDATRWLDR+LIRLCSKFGD Sbjct: 482 EEGFDATRWLDRSLIRLCSKFGD 504 >ref|XP_002885585.1| hypothetical protein ARALYDRAFT_479878 [Arabidopsis lyrata subsp. lyrata] gi|297331425|gb|EFH61844.1| hypothetical protein ARALYDRAFT_479878 [Arabidopsis lyrata subsp. lyrata] Length = 769 Score = 60.8 bits (146), Expect(2) = 6e-17 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 430 YRKDDPSSFTLNPCFSLFLQLIFNLRRSQFVQI 528 YRKDDP+SFTLNP FSLF Q IFNLRRSQFVQ+ Sbjct: 567 YRKDDPASFTLNPYFSLFPQFIFNLRRSQFVQV 599 Score = 52.4 bits (124), Expect(2) = 6e-17 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +2 Query: 359 QEGFDATRWLDRNLIRLCSKFGD 427 +EGFDATRWLDRNLIRLCSKFGD Sbjct: 544 EEGFDATRWLDRNLIRLCSKFGD 566 >ref|NP_189008.1| protein transport protein SEC23 [Arabidopsis thaliana] gi|9294523|dbj|BAB02785.1| protein transport protein Sec23 [Arabidopsis thaliana] gi|27754566|gb|AAO22730.1| putative transport protein [Arabidopsis thaliana] gi|28827624|gb|AAO50656.1| putative transport protein [Arabidopsis thaliana] gi|332643275|gb|AEE76796.1| protein transport protein SEC23 [Arabidopsis thaliana] Length = 765 Score = 60.8 bits (146), Expect(2) = 6e-17 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 430 YRKDDPSSFTLNPCFSLFLQLIFNLRRSQFVQI 528 YRKDDP+SFTLNP FSLF Q IFNLRRSQFVQ+ Sbjct: 563 YRKDDPASFTLNPYFSLFPQFIFNLRRSQFVQV 595 Score = 52.4 bits (124), Expect(2) = 6e-17 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +2 Query: 359 QEGFDATRWLDRNLIRLCSKFGD 427 +EGFDATRWLDRNLIRLCSKFGD Sbjct: 540 EEGFDATRWLDRNLIRLCSKFGD 562