BLASTX nr result
ID: Panax21_contig00009113
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00009113 (360 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003539131.1| PREDICTED: regulator of nonsense transcripts... 77 1e-12 ref|XP_003517385.1| PREDICTED: regulator of nonsense transcripts... 77 1e-12 ref|XP_003611424.1| Regulator of nonsense transcripts-like prote... 77 1e-12 ref|XP_004163978.1| PREDICTED: regulator of nonsense transcripts... 76 2e-12 ref|XP_004150168.1| PREDICTED: LOW QUALITY PROTEIN: regulator of... 76 2e-12 >ref|XP_003539131.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Glycine max] Length = 1270 Score = 77.4 bits (189), Expect = 1e-12 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -1 Query: 273 MGQEEISASGTSYLNRTEAANVEKIMTTFLKSGVVPSQFSSLTCEDG 133 MGQEEISASGTSYLNRTEAANVEKI+TTFLKSGVVPSQ +T +G Sbjct: 769 MGQEEISASGTSYLNRTEAANVEKIVTTFLKSGVVPSQIGVITPYEG 815 >ref|XP_003517385.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Glycine max] Length = 1266 Score = 77.4 bits (189), Expect = 1e-12 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -1 Query: 273 MGQEEISASGTSYLNRTEAANVEKIMTTFLKSGVVPSQFSSLTCEDG 133 MGQEEISASGTSYLNRTEAANVEKI+TTFLKSGVVPSQ +T +G Sbjct: 766 MGQEEISASGTSYLNRTEAANVEKIVTTFLKSGVVPSQIGVITPYEG 812 >ref|XP_003611424.1| Regulator of nonsense transcripts-like protein [Medicago truncatula] gi|355512759|gb|AES94382.1| Regulator of nonsense transcripts-like protein [Medicago truncatula] Length = 1253 Score = 77.4 bits (189), Expect = 1e-12 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -1 Query: 273 MGQEEISASGTSYLNRTEAANVEKIMTTFLKSGVVPSQFSSLTCEDG 133 MGQEEISASGTSYLNRTEAANVEKI+TTFLKSGVVPSQ +T +G Sbjct: 760 MGQEEISASGTSYLNRTEAANVEKIVTTFLKSGVVPSQIGVITPYEG 806 >ref|XP_004163978.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Cucumis sativus] Length = 1268 Score = 76.3 bits (186), Expect = 2e-12 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = -1 Query: 273 MGQEEISASGTSYLNRTEAANVEKIMTTFLKSGVVPSQFSSLTCEDG 133 MGQEEISASGTSYLNRTEAANVEKI+TTFL+SGVVPSQ +T +G Sbjct: 766 MGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYEG 812 >ref|XP_004150168.1| PREDICTED: LOW QUALITY PROTEIN: regulator of nonsense transcripts 1 homolog [Cucumis sativus] Length = 1246 Score = 76.3 bits (186), Expect = 2e-12 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = -1 Query: 273 MGQEEISASGTSYLNRTEAANVEKIMTTFLKSGVVPSQFSSLTCEDG 133 MGQEEISASGTSYLNRTEAANVEKI+TTFL+SGVVPSQ +T +G Sbjct: 766 MGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYEG 812