BLASTX nr result
ID: Panax21_contig00008337
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00008337 (538 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173429.1| hypothetical protein NitaMp090 [Nicotiana tabac... 65 5e-09 ref|XP_003617143.1| Oligoribonuclease [Medicago truncatula] gi|3... 64 1e-08 ref|XP_003622239.1| HAT family dimerization domain containing pr... 59 4e-07 ref|XP_003609012.1| hypothetical protein MTR_4g107900 [Medicago ... 59 4e-07 ref|XP_003612259.1| Phospholipase D delta isoform [Medicago trun... 56 3e-06 >ref|YP_173429.1| hypothetical protein NitaMp090 [Nicotiana tabacum] gi|56806593|dbj|BAD83494.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 119 Score = 65.5 bits (158), Expect = 5e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 228 SPTARVKGESKDYVQPGVTCQRSPSRRKGE 317 SPTARVKGESKDYVQPGVTCQRSPSRRKGE Sbjct: 90 SPTARVKGESKDYVQPGVTCQRSPSRRKGE 119 >ref|XP_003617143.1| Oligoribonuclease [Medicago truncatula] gi|355518478|gb|AET00102.1| Oligoribonuclease [Medicago truncatula] Length = 1551 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/52 (61%), Positives = 41/52 (78%), Gaps = 2/52 (3%) Frame = +1 Query: 379 EGESTNNCLWK--FDVDLTRAALAYMILVDELPFKFVENEGFRHFMSIACPR 528 +G S+N+ + FDVD++R ALA MI+VDELPF FVENEGFR+FMS+ PR Sbjct: 1025 KGTSSNSTIVAVHFDVDVSRQALARMIIVDELPFSFVENEGFRYFMSVTQPR 1076 >ref|XP_003622239.1| HAT family dimerization domain containing protein [Medicago truncatula] gi|355497254|gb|AES78457.1| HAT family dimerization domain containing protein [Medicago truncatula] Length = 255 Score = 59.3 bits (142), Expect = 4e-07 Identities = 31/65 (47%), Positives = 41/65 (63%), Gaps = 1/65 (1%) Frame = +1 Query: 337 NFKSASANNDDETMEGESTNNCLW-KFDVDLTRAALAYMILVDELPFKFVENEGFRHFMS 513 N + N+ D S+N + FDVD+ ALA I++DELPF FVENEGFR+FMS Sbjct: 58 NPNQTTLNHQDSKGTSSSSNTIVAVHFDVDVCSQALARTIILDELPFSFVENEGFRYFMS 117 Query: 514 IACPR 528 ++ PR Sbjct: 118 VSQPR 122 >ref|XP_003609012.1| hypothetical protein MTR_4g107900 [Medicago truncatula] gi|355510067|gb|AES91209.1| hypothetical protein MTR_4g107900 [Medicago truncatula] Length = 181 Score = 59.3 bits (142), Expect = 4e-07 Identities = 30/58 (51%), Positives = 40/58 (68%) Frame = +1 Query: 364 DDETMEGESTNNCLWKFDVDLTRAALAYMILVDELPFKFVENEGFRHFMSIACPRFNV 537 +DET G + + FDV+ R ALA MI+VDELPFKF+E E FR+F+S+ PRF + Sbjct: 97 EDETGTGSTLSGV--HFDVEACRKALAKMIIVDELPFKFLEGEEFRYFVSVVQPRFPI 152 >ref|XP_003612259.1| Phospholipase D delta isoform [Medicago truncatula] gi|355513594|gb|AES95217.1| Phospholipase D delta isoform [Medicago truncatula] Length = 1102 Score = 56.2 bits (134), Expect = 3e-06 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 2/70 (2%) Frame = +1 Query: 334 SNFKSASANNDDETMEGESTNNCLWK--FDVDLTRAALAYMILVDELPFKFVENEGFRHF 507 SN K + +G T++ L FDV++ R AL MI+VDELPFKF+E E F +F Sbjct: 1023 SNDKQTQTLQQLKKEDGTGTSSTLSSVHFDVEVCRKALVRMIIVDELPFKFLEGEEFCYF 1082 Query: 508 MSIACPRFNV 537 MS+ PRF + Sbjct: 1083 MSVGQPRFPI 1092