BLASTX nr result
ID: Panax21_contig00008292
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00008292 (465 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002321745.1| predicted protein [Populus trichocarpa] gi|2... 74 9e-12 ref|XP_002318164.1| predicted protein [Populus trichocarpa] gi|2... 74 1e-11 gb|AAB80670.1| putative serine carboxypeptidase II [Arabidopsis ... 72 6e-11 ref|XP_002511104.1| serine carboxypeptidase, putative [Ricinus c... 71 1e-10 ref|NP_850212.1| serine carboxypeptidase-like 46 [Arabidopsis th... 70 2e-10 >ref|XP_002321745.1| predicted protein [Populus trichocarpa] gi|222868741|gb|EEF05872.1| predicted protein [Populus trichocarpa] Length = 436 Score = 74.3 bits (181), Expect = 9e-12 Identities = 30/42 (71%), Positives = 40/42 (95%) Frame = -3 Query: 358 KQLTERIDVCLEDETINYLNLKDAQKALHAQLVGVRKWDVCS 233 KQ++ERIDVC+EDET+NYLN KD ++ALHA+L+GVR+W+VCS Sbjct: 271 KQVSERIDVCIEDETVNYLNRKDVRRALHARLIGVRRWEVCS 312 >ref|XP_002318164.1| predicted protein [Populus trichocarpa] gi|222858837|gb|EEE96384.1| predicted protein [Populus trichocarpa] Length = 442 Score = 73.9 bits (180), Expect = 1e-11 Identities = 30/42 (71%), Positives = 40/42 (95%) Frame = -3 Query: 358 KQLTERIDVCLEDETINYLNLKDAQKALHAQLVGVRKWDVCS 233 KQ++ERIDVC+EDET+NYLN +D +KALHA+L+GVR+W+VCS Sbjct: 281 KQVSERIDVCIEDETVNYLNREDVRKALHARLIGVRRWEVCS 322 >gb|AAB80670.1| putative serine carboxypeptidase II [Arabidopsis thaliana] Length = 458 Score = 71.6 bits (174), Expect = 6e-11 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -3 Query: 358 KQLTERIDVCLEDETINYLNLKDAQKALHAQLVGVRKWDVCS 233 KQ+ E +DVCLEDET+NYLN +D QKALHA+LVG RKW VCS Sbjct: 297 KQVGETVDVCLEDETVNYLNRRDVQKALHARLVGTRKWTVCS 338 >ref|XP_002511104.1| serine carboxypeptidase, putative [Ricinus communis] gi|223550219|gb|EEF51706.1| serine carboxypeptidase, putative [Ricinus communis] Length = 460 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/42 (71%), Positives = 39/42 (92%) Frame = -3 Query: 358 KQLTERIDVCLEDETINYLNLKDAQKALHAQLVGVRKWDVCS 233 +Q++ERIDVC++DET+NYLN KD QKALHA+LVGV +W+VCS Sbjct: 299 QQVSERIDVCVDDETMNYLNRKDVQKALHARLVGVGRWEVCS 340 >ref|NP_850212.1| serine carboxypeptidase-like 46 [Arabidopsis thaliana] gi|75161390|sp|Q8VY01.1|SCP46_ARATH RecName: Full=Serine carboxypeptidase-like 46; Flags: Precursor gi|18377727|gb|AAL67013.1| putative serine carboxypeptidase II [Arabidopsis thaliana] gi|330253755|gb|AEC08849.1| serine carboxypeptidase-like 46 [Arabidopsis thaliana] Length = 465 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -3 Query: 358 KQLTERIDVCLEDETINYLNLKDAQKALHAQLVGVRKWDVCS 233 +Q+ E +DVCLEDET+NYLN +D QKALHA+LVG RKW VCS Sbjct: 304 QQVGETVDVCLEDETVNYLNRRDVQKALHARLVGTRKWTVCS 345