BLASTX nr result
ID: Panax21_contig00008253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00008253 (510 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517157.1| chloroplast-targeted copper chaperone, putat... 125 4e-27 ref|XP_003550023.1| PREDICTED: uncharacterized protein LOC100777... 125 5e-27 ref|XP_003529611.1| PREDICTED: uncharacterized protein LOC100804... 123 2e-26 ref|NP_001189822.1| heavy-metal-associated domain-containing pro... 122 4e-26 ref|XP_002884560.1| hypothetical protein ARALYDRAFT_477915 [Arab... 122 4e-26 >ref|XP_002517157.1| chloroplast-targeted copper chaperone, putative [Ricinus communis] gi|223543792|gb|EEF45320.1| chloroplast-targeted copper chaperone, putative [Ricinus communis] Length = 526 Score = 125 bits (314), Expect = 4e-27 Identities = 61/66 (92%), Positives = 62/66 (93%) Frame = -2 Query: 200 MSKEEFLKIQTCVLKVNIHCDGCKHKVKKILQKIDGVYTTKIDSEQGKVTVSGNVDPATL 21 MSKEEFLKIQTCVLKVNIHCDGCK KVKKILQKIDGV+TT IDSEQGKVTVSGNVDPA L Sbjct: 1 MSKEEFLKIQTCVLKVNIHCDGCKQKVKKILQKIDGVFTTSIDSEQGKVTVSGNVDPAVL 60 Query: 20 IKKLTK 3 IKKL K Sbjct: 61 IKKLAK 66 >ref|XP_003550023.1| PREDICTED: uncharacterized protein LOC100777182 [Glycine max] Length = 499 Score = 125 bits (313), Expect = 5e-27 Identities = 60/66 (90%), Positives = 63/66 (95%) Frame = -2 Query: 200 MSKEEFLKIQTCVLKVNIHCDGCKHKVKKILQKIDGVYTTKIDSEQGKVTVSGNVDPATL 21 MSKEEFLKIQ CVLKVNIHCDGCKHKVKKILQKIDGV+TT+ID+EQGKVTVSGNVDP L Sbjct: 1 MSKEEFLKIQKCVLKVNIHCDGCKHKVKKILQKIDGVFTTEIDAEQGKVTVSGNVDPNVL 60 Query: 20 IKKLTK 3 IKKLTK Sbjct: 61 IKKLTK 66 >ref|XP_003529611.1| PREDICTED: uncharacterized protein LOC100804757 [Glycine max] Length = 490 Score = 123 bits (308), Expect = 2e-26 Identities = 59/66 (89%), Positives = 62/66 (93%) Frame = -2 Query: 200 MSKEEFLKIQTCVLKVNIHCDGCKHKVKKILQKIDGVYTTKIDSEQGKVTVSGNVDPATL 21 MSKEEFLKIQ CVLKVNIHCDGCKHKVKKILQKIDGV+TT+ID+EQGKVTVSGNVDP L Sbjct: 1 MSKEEFLKIQKCVLKVNIHCDGCKHKVKKILQKIDGVFTTEIDAEQGKVTVSGNVDPNVL 60 Query: 20 IKKLTK 3 IKKL K Sbjct: 61 IKKLAK 66 >ref|NP_001189822.1| heavy-metal-associated domain-containing protein [Arabidopsis thaliana] gi|332640828|gb|AEE74349.1| heavy-metal-associated domain-containing protein [Arabidopsis thaliana] Length = 349 Score = 122 bits (305), Expect = 4e-26 Identities = 58/66 (87%), Positives = 63/66 (95%) Frame = -2 Query: 200 MSKEEFLKIQTCVLKVNIHCDGCKHKVKKILQKIDGVYTTKIDSEQGKVTVSGNVDPATL 21 MSKEEF+KIQTCVLKVNIHCDGCK KVKKILQKI+GV+TTKIDSEQGKVTVSG+VDP+ L Sbjct: 1 MSKEEFMKIQTCVLKVNIHCDGCKQKVKKILQKIEGVFTTKIDSEQGKVTVSGSVDPSVL 60 Query: 20 IKKLTK 3 IKKL K Sbjct: 61 IKKLAK 66 >ref|XP_002884560.1| hypothetical protein ARALYDRAFT_477915 [Arabidopsis lyrata subsp. lyrata] gi|297330400|gb|EFH60819.1| hypothetical protein ARALYDRAFT_477915 [Arabidopsis lyrata subsp. lyrata] Length = 445 Score = 122 bits (305), Expect = 4e-26 Identities = 58/66 (87%), Positives = 63/66 (95%) Frame = -2 Query: 200 MSKEEFLKIQTCVLKVNIHCDGCKHKVKKILQKIDGVYTTKIDSEQGKVTVSGNVDPATL 21 MSKEEF+KIQTCVLKVNIHCDGCK KVKKILQKI+GV+TTKIDSEQGKVTVSG+VDP+ L Sbjct: 1 MSKEEFMKIQTCVLKVNIHCDGCKQKVKKILQKIEGVFTTKIDSEQGKVTVSGSVDPSVL 60 Query: 20 IKKLTK 3 IKKL K Sbjct: 61 IKKLAK 66