BLASTX nr result
ID: Panax21_contig00008142
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00008142 (1979 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004144431.1| PREDICTED: uncharacterized protein LOC101203... 73 3e-10 ref|XP_002303235.1| predicted protein [Populus trichocarpa] gi|2... 73 3e-10 ref|XP_004164136.1| PREDICTED: uncharacterized protein LOC101228... 72 4e-10 ref|XP_002532722.1| triacylglycerol lipase, putative [Ricinus co... 72 4e-10 ref|NP_566475.1| lipase class 3 family protein [Arabidopsis thal... 71 9e-10 >ref|XP_004144431.1| PREDICTED: uncharacterized protein LOC101203983 [Cucumis sativus] Length = 657 Score = 72.8 bits (177), Expect = 3e-10 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +3 Query: 1356 AACMTWEIADSGNEFITSVINGIDLVPTFSAVSVDDLCAE 1475 AACMTWE+A+SGNEFITSVING DLVPTFSA SVDDL +E Sbjct: 292 AACMTWELAESGNEFITSVINGADLVPTFSAASVDDLRSE 331 >ref|XP_002303235.1| predicted protein [Populus trichocarpa] gi|222840667|gb|EEE78214.1| predicted protein [Populus trichocarpa] Length = 652 Score = 72.8 bits (177), Expect = 3e-10 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +3 Query: 1356 AACMTWEIADSGNEFITSVINGIDLVPTFSAVSVDDLCAE 1475 AACMTWE+A+SGN+FITSVING DLVPTFSA SVDDL AE Sbjct: 296 AACMTWELAESGNDFITSVINGADLVPTFSAASVDDLRAE 335 >ref|XP_004164136.1| PREDICTED: uncharacterized protein LOC101228936 [Cucumis sativus] Length = 657 Score = 72.4 bits (176), Expect = 4e-10 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +3 Query: 1356 AACMTWEIADSGNEFITSVINGIDLVPTFSAVSVDDLCAE 1475 AACMTWE+A+SGNEFITSVING DLVPTFSA SVDDL E Sbjct: 292 AACMTWELAESGNEFITSVINGADLVPTFSAASVDDLRGE 331 >ref|XP_002532722.1| triacylglycerol lipase, putative [Ricinus communis] gi|223527530|gb|EEF29653.1| triacylglycerol lipase, putative [Ricinus communis] Length = 518 Score = 72.4 bits (176), Expect = 4e-10 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +3 Query: 1356 AACMTWEIADSGNEFITSVINGIDLVPTFSAVSVDDLCAE 1475 AACMTWE+A+SGN+FITS+ING DLVPTFSA SVDDL AE Sbjct: 146 AACMTWELAESGNDFITSIINGADLVPTFSAASVDDLRAE 185 >ref|NP_566475.1| lipase class 3 family protein [Arabidopsis thaliana] gi|334185334|ref|NP_001189887.1| lipase class 3 family protein [Arabidopsis thaliana] gi|15146181|gb|AAK83574.1| AT3g14070/MAG2_2 [Arabidopsis thaliana] gi|27764916|gb|AAO23579.1| At3g14070/MAG2_2 [Arabidopsis thaliana] gi|332641942|gb|AEE75463.1| lipase class 3 family protein [Arabidopsis thaliana] gi|332641943|gb|AEE75464.1| lipase class 3 family protein [Arabidopsis thaliana] Length = 642 Score = 71.2 bits (173), Expect = 9e-10 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +3 Query: 1356 AACMTWEIADSGNEFITSVINGIDLVPTFSAVSVDDLCAE 1475 AACMTWE+ADSGN+FI SVING DLVPTFSA +VDDL AE Sbjct: 291 AACMTWELADSGNDFIVSVINGADLVPTFSAAAVDDLRAE 330