BLASTX nr result
ID: Panax21_contig00006154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00006154 (478 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525318.1| phd finger transcription factor, putative [R... 89 4e-16 ref|XP_004144509.1| PREDICTED: BAH and coiled-coil domain-contai... 84 9e-15 ref|XP_002301607.1| ebs-bah-phd domain-containing protein [Popul... 84 9e-15 ref|XP_002273680.1| PREDICTED: BAH and coiled-coil domain-contai... 84 2e-14 ref|XP_002321145.1| ebs-bah-phd domain-containing protein [Popul... 83 2e-14 >ref|XP_002525318.1| phd finger transcription factor, putative [Ricinus communis] gi|223535377|gb|EEF37051.1| phd finger transcription factor, putative [Ricinus communis] Length = 209 Score = 89.0 bits (219), Expect = 4e-16 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +1 Query: 49 FHPSCMGMTIEEAKKLEQFLCSDCASDEDAKRSLTSFPVSPSVEAK 186 FHPSCMGMTIEEAKKL+ FLCSDC+SD+DAKRSL +FPVSPSVEAK Sbjct: 163 FHPSCMGMTIEEAKKLDHFLCSDCSSDDDAKRSLNAFPVSPSVEAK 208 >ref|XP_004144509.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Cucumis sativus] gi|449493160|ref|XP_004159209.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Cucumis sativus] Length = 216 Score = 84.3 bits (207), Expect = 9e-15 Identities = 39/54 (72%), Positives = 47/54 (87%) Frame = +1 Query: 49 FHPSCMGMTIEEAKKLEQFLCSDCASDEDAKRSLTSFPVSPSVEAKTLVSPEKQ 210 FHPSCMGMTIEEAKKL+ FLCSDC+S+ +AKRSL +FPVSPS EAK V P+++ Sbjct: 163 FHPSCMGMTIEEAKKLDHFLCSDCSSENEAKRSLNAFPVSPSAEAK--VEPKRR 214 >ref|XP_002301607.1| ebs-bah-phd domain-containing protein [Populus trichocarpa] gi|222843333|gb|EEE80880.1| ebs-bah-phd domain-containing protein [Populus trichocarpa] Length = 208 Score = 84.3 bits (207), Expect = 9e-15 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = +1 Query: 49 FHPSCMGMTIEEAKKLEQFLCSDCASDEDAKRSLTSFPVSPSVEAK 186 FHPSCMGMTIEEAKKL+ FLCSDC+S++DAKRS+ FPVSPS+EAK Sbjct: 163 FHPSCMGMTIEEAKKLDHFLCSDCSSEDDAKRSMNVFPVSPSLEAK 208 >ref|XP_002273680.1| PREDICTED: BAH and coiled-coil domain-containing protein 1 isoform 1 [Vitis vinifera] gi|359485509|ref|XP_003633285.1| PREDICTED: BAH and coiled-coil domain-containing protein 1 isoform 2 [Vitis vinifera] gi|297739198|emb|CBI28849.3| unnamed protein product [Vitis vinifera] Length = 215 Score = 83.6 bits (205), Expect = 2e-14 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = +1 Query: 49 FHPSCMGMTIEEAKKLEQFLCSDCASDEDAKRSLTSFPVSPSVEAKTLVSPEKQ 210 FHPSCMGMTIEEAKKL+ FLCSDC+SD+DAKRSL +FPVSPS EAK V P+++ Sbjct: 163 FHPSCMGMTIEEAKKLDHFLCSDCSSDDDAKRSLNAFPVSPS-EAK--VEPKRR 213 >ref|XP_002321145.1| ebs-bah-phd domain-containing protein [Populus trichocarpa] gi|222861918|gb|EEE99460.1| ebs-bah-phd domain-containing protein [Populus trichocarpa] Length = 216 Score = 83.2 bits (204), Expect = 2e-14 Identities = 38/54 (70%), Positives = 43/54 (79%) Frame = +1 Query: 49 FHPSCMGMTIEEAKKLEQFLCSDCASDEDAKRSLTSFPVSPSVEAKTLVSPEKQ 210 FHPSCMGMTIEEAKK + FLCSDC+SD+DAKRSL FPVSPS+E K K+ Sbjct: 163 FHPSCMGMTIEEAKKSDHFLCSDCSSDDDAKRSLNVFPVSPSLEVKVETKRRKR 216