BLASTX nr result
ID: Panax21_contig00000964
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00000964 (354 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM65602.1| unknown [Arabidopsis thaliana] 57 2e-06 ref|NP_563883.1| RING/FYVE/PHD zinc finger-containing protein [A... 57 2e-06 gb|AFK48121.1| unknown [Lotus japonicus] 55 5e-06 ref|XP_002309239.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 ref|XP_002332377.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 >gb|AAM65602.1| unknown [Arabidopsis thaliana] Length = 320 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/35 (80%), Positives = 31/35 (88%), Gaps = 3/35 (8%) Frame = +3 Query: 93 VIAVIAGFAYLLDKDGTFRNSFN---DRILSKHPI 188 VIAV+AGFAY++DKDG FRNSFN DRILSKHPI Sbjct: 154 VIAVMAGFAYMMDKDGEFRNSFNDDWDRILSKHPI 188 >ref|NP_563883.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana] gi|26449897|dbj|BAC42070.1| unknown protein [Arabidopsis thaliana] gi|28827244|gb|AAO50466.1| unknown protein [Arabidopsis thaliana] gi|51971114|dbj|BAD44249.1| unknown protein [Arabidopsis thaliana] gi|332190554|gb|AEE28675.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana] Length = 321 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/35 (80%), Positives = 31/35 (88%), Gaps = 3/35 (8%) Frame = +3 Query: 93 VIAVIAGFAYLLDKDGTFRNSFN---DRILSKHPI 188 VIAV+AGFAY++DKDG FRNSFN DRILSKHPI Sbjct: 155 VIAVMAGFAYMMDKDGEFRNSFNDDWDRILSKHPI 189 >gb|AFK48121.1| unknown [Lotus japonicus] Length = 307 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/35 (77%), Positives = 30/35 (85%), Gaps = 3/35 (8%) Frame = +3 Query: 93 VIAVIAGFAYLLDKDGTFRNSFN---DRILSKHPI 188 VIA I GFAY++DKDGTFRNSF+ DRILSKHPI Sbjct: 141 VIAAIGGFAYIMDKDGTFRNSFDDGWDRILSKHPI 175 >ref|XP_002309239.1| predicted protein [Populus trichocarpa] gi|222855215|gb|EEE92762.1| predicted protein [Populus trichocarpa] Length = 310 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/35 (77%), Positives = 30/35 (85%), Gaps = 3/35 (8%) Frame = +3 Query: 93 VIAVIAGFAYLLDKDGTFRNSFN---DRILSKHPI 188 VIA + GFAYL+DKDGTFRNSF+ DRILSKHPI Sbjct: 144 VIAAMGGFAYLMDKDGTFRNSFSDGWDRILSKHPI 178 >ref|XP_002332377.1| predicted protein [Populus trichocarpa] gi|222832201|gb|EEE70678.1| predicted protein [Populus trichocarpa] Length = 308 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/35 (77%), Positives = 30/35 (85%), Gaps = 3/35 (8%) Frame = +3 Query: 93 VIAVIAGFAYLLDKDGTFRNSFN---DRILSKHPI 188 VIA + GFAYL+DKDGTFRNSF+ DRILSKHPI Sbjct: 142 VIAAMGGFAYLMDKDGTFRNSFSDGWDRILSKHPI 176