BLASTX nr result
ID: Panax21_contig00000882
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00000882 (821 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522819.1| histone h2a, putative [Ricinus communis] gi|... 72 1e-10 ref|NP_172363.1| putative histone H2AXa [Arabidopsis thaliana] g... 72 1e-10 ref|XP_002305641.1| histone H2 [Populus trichocarpa] gi|22284860... 72 2e-10 ref|XP_004148883.1| PREDICTED: histone H2AX-like [Cucumis sativu... 71 3e-10 ref|XP_004135645.1| PREDICTED: probable histone H2AXb-like [Cucu... 71 3e-10 >ref|XP_002522819.1| histone h2a, putative [Ricinus communis] gi|223537903|gb|EEF39517.1| histone h2a, putative [Ricinus communis] Length = 135 Score = 72.0 bits (175), Expect = 1e-10 Identities = 38/43 (88%), Positives = 39/43 (90%) Frame = +2 Query: 668 AGLQFPVGRIARFLKNGKYAERVGAGATVYLSVAVLEYLGAEG 796 AGLQFPVGRIARFLK GKYAERVGAGA VYL+ AVLEYL AEG Sbjct: 23 AGLQFPVGRIARFLKAGKYAERVGAGAPVYLA-AVLEYLAAEG 64 >ref|NP_172363.1| putative histone H2AXa [Arabidopsis thaliana] gi|75276926|sp|O04848.1|H2AXA_ARATH RecName: Full=Probable histone H2AXa; AltName: Full=HTA5 gi|15724304|gb|AAL06545.1|AF412092_1 At1g08880/F7G19_24 [Arabidopsis thaliana] gi|1922944|gb|AAB70416.1| Strong similarity to Picea histone H2A (gb|X67819). ESTs gb|ATTS3874,gb|T46627,gb|T14194 come from this gene [Arabidopsis thaliana] gi|20334750|gb|AAM16236.1| At1g08880/F7G19_24 [Arabidopsis thaliana] gi|332190240|gb|AEE28361.1| putative histone H2AXa [Arabidopsis thaliana] Length = 142 Score = 72.0 bits (175), Expect = 1e-10 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +2 Query: 668 AGLQFPVGRIARFLKNGKYAERVGAGATVYLSVAVLEYLGAE 793 AGLQFPVGRIARFLK+GKYAERVGAGA VYLS AVLEYL AE Sbjct: 29 AGLQFPVGRIARFLKSGKYAERVGAGAPVYLS-AVLEYLAAE 69 >ref|XP_002305641.1| histone H2 [Populus trichocarpa] gi|222848605|gb|EEE86152.1| histone H2 [Populus trichocarpa] Length = 130 Score = 71.6 bits (174), Expect = 2e-10 Identities = 38/42 (90%), Positives = 38/42 (90%) Frame = +2 Query: 668 AGLQFPVGRIARFLKNGKYAERVGAGATVYLSVAVLEYLGAE 793 AGLQFPVGRIARFLK GKYAERVGAGA VYLS AVLEYL AE Sbjct: 23 AGLQFPVGRIARFLKTGKYAERVGAGAPVYLS-AVLEYLAAE 63 >ref|XP_004148883.1| PREDICTED: histone H2AX-like [Cucumis sativus] gi|449528788|ref|XP_004171385.1| PREDICTED: histone H2AX-like [Cucumis sativus] Length = 139 Score = 70.9 bits (172), Expect = 3e-10 Identities = 38/42 (90%), Positives = 38/42 (90%) Frame = +2 Query: 668 AGLQFPVGRIARFLKNGKYAERVGAGATVYLSVAVLEYLGAE 793 AGLQFPVGRIARFLK GKYAERVGAGA VYLS AVLEYL AE Sbjct: 26 AGLQFPVGRIARFLKAGKYAERVGAGAPVYLS-AVLEYLAAE 66 >ref|XP_004135645.1| PREDICTED: probable histone H2AXb-like [Cucumis sativus] gi|449485770|ref|XP_004157270.1| PREDICTED: probable histone H2AXb-like [Cucumis sativus] Length = 140 Score = 70.9 bits (172), Expect = 3e-10 Identities = 38/42 (90%), Positives = 38/42 (90%) Frame = +2 Query: 668 AGLQFPVGRIARFLKNGKYAERVGAGATVYLSVAVLEYLGAE 793 AGLQFPVGRIARFLK GKYAERVGAGA VYLS AVLEYL AE Sbjct: 27 AGLQFPVGRIARFLKAGKYAERVGAGAPVYLS-AVLEYLAAE 67