BLASTX nr result
ID: Panax21_contig00000840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00000840 (476 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514291.1| signal peptidase I, putative [Ricinus commun... 75 6e-12 ref|XP_002324423.1| predicted protein [Populus trichocarpa] gi|2... 75 6e-12 ref|XP_002883537.1| signal peptidase I family protein [Arabidops... 74 1e-11 gb|AAN72018.1| chloroplast thylakoidal processing peptidase, put... 74 2e-11 dbj|BAB02011.1| unnamed protein product [Arabidopsis thaliana] 74 2e-11 >ref|XP_002514291.1| signal peptidase I, putative [Ricinus communis] gi|223546747|gb|EEF48245.1| signal peptidase I, putative [Ricinus communis] Length = 313 Score = 75.1 bits (183), Expect = 6e-12 Identities = 35/58 (60%), Positives = 41/58 (70%) Frame = +1 Query: 277 KEEDFILGAPKYEMTPVRVPENSVFVMGDNRNNGYDSHVWKTASTTCLTILGIKFLCY 450 + E+FIL +P Y+MTP+RVPENSVFVMGDNRNN YDSHVW I+G F Y Sbjct: 228 RNENFILESPSYDMTPIRVPENSVFVMGDNRNNSYDSHVW--GPLPAKNIIGRSFFRY 283 >ref|XP_002324423.1| predicted protein [Populus trichocarpa] gi|222865857|gb|EEF02988.1| predicted protein [Populus trichocarpa] Length = 202 Score = 75.1 bits (183), Expect = 6e-12 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +1 Query: 274 MKEEDFILGAPKYEMTPVRVPENSVFVMGDNRNNGYDSHVW 396 ++ E FIL +P YEMTPVRVPENSVFVMGDNRNN YDSHVW Sbjct: 119 VRSEKFILESPLYEMTPVRVPENSVFVMGDNRNNSYDSHVW 159 >ref|XP_002883537.1| signal peptidase I family protein [Arabidopsis lyrata subsp. lyrata] gi|297329377|gb|EFH59796.1| signal peptidase I family protein [Arabidopsis lyrata subsp. lyrata] Length = 290 Score = 73.9 bits (180), Expect = 1e-11 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = +1 Query: 277 KEEDFILGAPKYEMTPVRVPENSVFVMGDNRNNGYDSHVW 396 + E FIL P YEMTPVRVPENSVFVMGDNRNN YDSHVW Sbjct: 217 RNEKFILEPPGYEMTPVRVPENSVFVMGDNRNNSYDSHVW 256 >gb|AAN72018.1| chloroplast thylakoidal processing peptidase, putative [Arabidopsis thaliana] Length = 291 Score = 73.6 bits (179), Expect = 2e-11 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +1 Query: 277 KEEDFILGAPKYEMTPVRVPENSVFVMGDNRNNGYDSHVW 396 + E FIL P YEMTP+RVPENSVFVMGDNRNN YDSHVW Sbjct: 216 RNEKFILEPPGYEMTPIRVPENSVFVMGDNRNNSYDSHVW 255 >dbj|BAB02011.1| unnamed protein product [Arabidopsis thaliana] Length = 310 Score = 73.6 bits (179), Expect = 2e-11 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +1 Query: 277 KEEDFILGAPKYEMTPVRVPENSVFVMGDNRNNGYDSHVW 396 + E FIL P YEMTP+RVPENSVFVMGDNRNN YDSHVW Sbjct: 235 RNEKFILEPPGYEMTPIRVPENSVFVMGDNRNNSYDSHVW 274