BLASTX nr result
ID: Panax21_contig00000761
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00000761 (479 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299126.1| predicted protein [Populus trichocarpa] gi|2... 154 5e-36 gb|AEC11000.1| hypothetical protein [Camellia sinensis] 147 7e-34 ref|XP_002304870.1| predicted protein [Populus trichocarpa] gi|2... 144 6e-33 gb|ACF74323.1| unknown [Arachis hypogaea] 136 2e-30 ref|XP_004142162.1| PREDICTED: uncharacterized protein LOC101215... 136 2e-30 >ref|XP_002299126.1| predicted protein [Populus trichocarpa] gi|222846384|gb|EEE83931.1| predicted protein [Populus trichocarpa] Length = 176 Score = 154 bits (390), Expect = 5e-36 Identities = 72/88 (81%), Positives = 80/88 (90%) Frame = +1 Query: 214 DEPQTVYEILPKFGLPSGLLPDNVKSYSLSSDGDFAVELEKECYIHFDYLVYYEKKITGK 393 D P++V+EILPKFGLPSGLLP+ VKSYSLS DG+F V LEKECY+ FDYLVYYEKKITGK Sbjct: 27 DPPRSVFEILPKFGLPSGLLPNTVKSYSLSDDGNFTVYLEKECYVEFDYLVYYEKKITGK 86 Query: 394 LSYGSITDLKGIQVKRFFLWFDVDEIKV 477 L YGSITDLKGIQV++FFLW DVDEIKV Sbjct: 87 LGYGSITDLKGIQVQKFFLWLDVDEIKV 114 >gb|AEC11000.1| hypothetical protein [Camellia sinensis] Length = 173 Score = 147 bits (372), Expect = 7e-34 Identities = 69/88 (78%), Positives = 76/88 (86%) Frame = +1 Query: 214 DEPQTVYEILPKFGLPSGLLPDNVKSYSLSSDGDFAVELEKECYIHFDYLVYYEKKITGK 393 DEP TVYEILPKFGLPSGLLPD VKSYSL DG+F V+L+K CYI FDYLVYYEK+ITG Sbjct: 30 DEPPTVYEILPKFGLPSGLLPDTVKSYSLDDDGNFVVDLDKPCYIQFDYLVYYEKRITGV 89 Query: 394 LSYGSITDLKGIQVKRFFLWFDVDEIKV 477 L YGSIT L+GIQV++ LWFDVDEIKV Sbjct: 90 LKYGSITHLEGIQVQKLLLWFDVDEIKV 117 >ref|XP_002304870.1| predicted protein [Populus trichocarpa] gi|222842302|gb|EEE79849.1| predicted protein [Populus trichocarpa] Length = 177 Score = 144 bits (364), Expect = 6e-33 Identities = 69/88 (78%), Positives = 75/88 (85%) Frame = +1 Query: 214 DEPQTVYEILPKFGLPSGLLPDNVKSYSLSSDGDFAVELEKECYIHFDYLVYYEKKITGK 393 D TV+EILPKFGLPSGLLP VKSYSLS DG F V LEKECY+ FDYLVYYEKKITGK Sbjct: 27 DPSPTVFEILPKFGLPSGLLPKTVKSYSLSDDGSFTVYLEKECYVEFDYLVYYEKKITGK 86 Query: 394 LSYGSITDLKGIQVKRFFLWFDVDEIKV 477 LSYGSI++LKGIQV+RFFLW VD I+V Sbjct: 87 LSYGSISNLKGIQVQRFFLWLGVDNIRV 114 >gb|ACF74323.1| unknown [Arachis hypogaea] Length = 181 Score = 136 bits (343), Expect = 2e-30 Identities = 62/85 (72%), Positives = 75/85 (88%) Frame = +1 Query: 223 QTVYEILPKFGLPSGLLPDNVKSYSLSSDGDFAVELEKECYIHFDYLVYYEKKITGKLSY 402 ++VY++LPK+GLPSGLLPD+V YSLS DG F V L++ CYI FDYLVYYE KITGKLSY Sbjct: 33 ESVYDLLPKYGLPSGLLPDSVTDYSLSDDGRFIVVLDQPCYIQFDYLVYYETKITGKLSY 92 Query: 403 GSITDLKGIQVKRFFLWFDVDEIKV 477 GSIT+L GIQV+RFF+WF+VDEI+V Sbjct: 93 GSITELNGIQVQRFFIWFNVDEIRV 117 >ref|XP_004142162.1| PREDICTED: uncharacterized protein LOC101215998 [Cucumis sativus] gi|449530349|ref|XP_004172158.1| PREDICTED: uncharacterized protein LOC101227250 [Cucumis sativus] Length = 176 Score = 136 bits (342), Expect = 2e-30 Identities = 62/84 (73%), Positives = 71/84 (84%) Frame = +1 Query: 226 TVYEILPKFGLPSGLLPDNVKSYSLSSDGDFAVELEKECYIHFDYLVYYEKKITGKLSYG 405 TVY++LPK+GLPSGLLPD+V Y+LSSDG F V L K CYIHFDYLVYY K ITGKL YG Sbjct: 32 TVYDVLPKYGLPSGLLPDSVLDYTLSSDGQFVVHLAKPCYIHFDYLVYYHKTITGKLEYG 91 Query: 406 SITDLKGIQVKRFFLWFDVDEIKV 477 SITDL GI+V++ FLWFDV EI+V Sbjct: 92 SITDLDGIEVQKLFLWFDVKEIRV 115