BLASTX nr result
ID: Panax21_contig00000733
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00000733 (362 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517858.1| 26S proteasome regulatory subunit rpn1, puta... 57 2e-06 >ref|XP_002517858.1| 26S proteasome regulatory subunit rpn1, putative [Ricinus communis] gi|223542840|gb|EEF44376.1| 26S proteasome regulatory subunit rpn1, putative [Ricinus communis] Length = 895 Score = 57.0 bits (136), Expect = 2e-06 Identities = 36/74 (48%), Positives = 38/74 (51%), Gaps = 3/74 (4%) Frame = -2 Query: 313 MAPDPNSASGSG---TTRDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQQLELYVERVQ 143 MAPDPN+ASGSG T RDE KQQLELYVER Q Sbjct: 1 MAPDPNNASGSGSGATARDEASVKVPSKDPKKKDEKKDEDLSDEDLALKQQLELYVERAQ 60 Query: 142 DSDPGLQKVALASL 101 D DP LQKVAL S+ Sbjct: 61 DPDPALQKVALESM 74