BLASTX nr result
ID: Panax21_contig00000702
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00000702 (467 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308060.1| predicted protein [Populus trichocarpa] gi|1... 69 1e-10 dbj|BAJ34930.1| hypothetical protein [Vitis hybrid cultivar] 70 1e-10 ref|XP_002285432.1| PREDICTED: repetitive proline-rich cell wall... 70 1e-10 gb|AFH57274.1| proline-rich protein [Gossypium hirsutum] 66 2e-10 gb|AAT42190.1| putative proline-rich protein [Nicotiana tabacum] 67 3e-10 >ref|XP_002308060.1| predicted protein [Populus trichocarpa] gi|118486483|gb|ABK95081.1| unknown [Populus trichocarpa] gi|222854036|gb|EEE91583.1| predicted protein [Populus trichocarpa] Length = 198 Score = 68.9 bits (167), Expect(2) = 1e-10 Identities = 34/61 (55%), Positives = 36/61 (59%) Frame = -3 Query: 192 GDPVANECCPVLGGLVELEAAVXXXXXXXXXXXXXXXXXXXXXXXLITCGKTPPPGYTCS 13 GDPV N+CCPVL GLVELEAAV L+TCGKTPPPGYTCS Sbjct: 138 GDPVVNQCCPVLTGLVELEAAVCLCTTLKIKALNLNIYVPLALQLLVTCGKTPPPGYTCS 197 Query: 12 L 10 L Sbjct: 198 L 198 Score = 21.9 bits (45), Expect(2) = 1e-10 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -1 Query: 329 KACPPPPS 306 K CPPPPS Sbjct: 103 KPCPPPPS 110 >dbj|BAJ34930.1| hypothetical protein [Vitis hybrid cultivar] Length = 244 Score = 70.5 bits (171), Expect = 1e-10 Identities = 35/61 (57%), Positives = 37/61 (60%) Frame = -3 Query: 192 GDPVANECCPVLGGLVELEAAVXXXXXXXXXXXXXXXXXXXXXXXLITCGKTPPPGYTCS 13 GDPVANECCPVL GLVELEAAV LITCGKTPPPGYTC+ Sbjct: 184 GDPVANECCPVLSGLVELEAAVCLCTTLKIKLLNLNIYVPLALQLLITCGKTPPPGYTCT 243 Query: 12 L 10 + Sbjct: 244 V 244 >ref|XP_002285432.1| PREDICTED: repetitive proline-rich cell wall protein 1 [Vitis vinifera] Length = 266 Score = 70.5 bits (171), Expect = 1e-10 Identities = 35/61 (57%), Positives = 37/61 (60%) Frame = -3 Query: 192 GDPVANECCPVLGGLVELEAAVXXXXXXXXXXXXXXXXXXXXXXXLITCGKTPPPGYTCS 13 GDPVANECCPVL GLVELEAAV LITCGKTPPPGYTC+ Sbjct: 206 GDPVANECCPVLSGLVELEAAVCLCTTLKIKLLNLNIYVPLALQLLITCGKTPPPGYTCT 265 Query: 12 L 10 + Sbjct: 266 V 266 >gb|AFH57274.1| proline-rich protein [Gossypium hirsutum] Length = 443 Score = 65.9 bits (159), Expect(2) = 2e-10 Identities = 34/61 (55%), Positives = 34/61 (55%) Frame = -3 Query: 192 GDPVANECCPVLGGLVELEAAVXXXXXXXXXXXXXXXXXXXXXXXLITCGKTPPPGYTCS 13 GDPV N CCPVL GLVELEAAV LI CGKTPPPGYTCS Sbjct: 383 GDPVVNACCPVLKGLVELEAAVCLCTTLKLKLLNLKIYAPIALQLLIPCGKTPPPGYTCS 442 Query: 12 L 10 L Sbjct: 443 L 443 Score = 23.9 bits (50), Expect(2) = 2e-10 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 329 KACPPPPST 303 K CPPPPST Sbjct: 348 KPCPPPPST 356 >gb|AAT42190.1| putative proline-rich protein [Nicotiana tabacum] Length = 195 Score = 66.6 bits (161), Expect(2) = 3e-10 Identities = 32/61 (52%), Positives = 34/61 (55%) Frame = -3 Query: 192 GDPVANECCPVLGGLVELEAAVXXXXXXXXXXXXXXXXXXXXXXXLITCGKTPPPGYTCS 13 GDP NECCP+L GLVELEAA L+TCGKTPPPGYTCS Sbjct: 135 GDPAVNECCPILHGLVELEAAACLCTTLKVKLLNLKIFVPLALQLLVTCGKTPPPGYTCS 194 Query: 12 L 10 L Sbjct: 195 L 195 Score = 22.7 bits (47), Expect(2) = 3e-10 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 329 KACPPPPST 303 K CPPPP+T Sbjct: 100 KPCPPPPTT 108