BLASTX nr result
ID: Panax21_contig00000596
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00000596 (526 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK26424.1| unknown [Picea sitchensis] 60 3e-07 ref|XP_002276955.2| PREDICTED: biotin carboxyl carrier protein o... 59 6e-07 emb|CBI17609.3| unnamed protein product [Vitis vinifera] 59 6e-07 emb|CAN80851.1| hypothetical protein VITISV_040144 [Vitis vinifera] 59 6e-07 ref|XP_002325474.1| predicted protein [Populus trichocarpa] gi|2... 58 7e-07 >gb|ABK26424.1| unknown [Picea sitchensis] Length = 309 Score = 59.7 bits (143), Expect = 3e-07 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = +3 Query: 312 VYSKDIMELQLKQRDYEVLIRKKEASPQPPVTAPYVMMQSHSPQA 446 V S+DIMELQLKQ+DYE+LIRKKEA P PP +P VM+ S P A Sbjct: 148 VDSRDIMELQLKQQDYEILIRKKEALPPPPSPSPPVMVHSLYPPA 192 >ref|XP_002276955.2| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic [Vitis vinifera] Length = 286 Score = 58.5 bits (140), Expect = 6e-07 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +3 Query: 312 VYSKDIMELQLKQRDYEVLIRKKEASPQPPVTAPYVMMQSHSPQAM 449 V S+DI+ELQ+KQ D E++IRKKEA PQPP AP VMM S P A+ Sbjct: 128 VDSRDIVELQMKQLDCELIIRKKEALPQPPSAAPVVMMHSPPPAAV 173 >emb|CBI17609.3| unnamed protein product [Vitis vinifera] Length = 280 Score = 58.5 bits (140), Expect = 6e-07 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +3 Query: 312 VYSKDIMELQLKQRDYEVLIRKKEASPQPPVTAPYVMMQSHSPQAM 449 V S+DI+ELQ+KQ D E++IRKKEA PQPP AP VMM S P A+ Sbjct: 122 VDSRDIVELQMKQLDCELIIRKKEALPQPPSAAPVVMMHSPPPAAV 167 >emb|CAN80851.1| hypothetical protein VITISV_040144 [Vitis vinifera] Length = 383 Score = 58.5 bits (140), Expect = 6e-07 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +3 Query: 312 VYSKDIMELQLKQRDYEVLIRKKEASPQPPVTAPYVMMQSHSPQAM 449 V S+DI+ELQ+KQ D E++IRKKEA PQPP AP VMM S P A+ Sbjct: 198 VDSRDIVELQMKQLDCELIIRKKEALPQPPSAAPVVMMHSPPPAAV 243 >ref|XP_002325474.1| predicted protein [Populus trichocarpa] gi|222862349|gb|EEE99855.1| predicted protein [Populus trichocarpa] Length = 284 Score = 58.2 bits (139), Expect = 7e-07 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = +3 Query: 312 VYSKDIMELQLKQRDYEVLIRKKEASPQPPVTAPYVMMQSHSP 440 V S+DI+ELQLKQ D E+LIRKKEA P PP +P VMM SH P Sbjct: 123 VDSRDIVELQLKQLDCELLIRKKEALPLPPYHSPVVMMHSHPP 165