BLASTX nr result
ID: Panax21_contig00000515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00000515 (583 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002468279.1| hypothetical protein SORBIDRAFT_01g042910 [S... 68 1e-09 ref|XP_002512077.1| hydrolase, putative [Ricinus communis] gi|22... 68 1e-09 ref|XP_002322254.1| predicted protein [Populus trichocarpa] gi|2... 68 1e-09 ref|NP_199851.2| purple acid phosphatase 27 [Arabidopsis thalian... 67 2e-09 dbj|BAB09459.1| unnamed protein product [Arabidopsis thaliana] 67 2e-09 >ref|XP_002468279.1| hypothetical protein SORBIDRAFT_01g042910 [Sorghum bicolor] gi|241922133|gb|EER95277.1| hypothetical protein SORBIDRAFT_01g042910 [Sorghum bicolor] Length = 618 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 480 YFGDLAYANGYISQWDQFTSQVEPIASTVPYMVA 581 + GD+AYANGY+SQWDQFT+QVEPIASTVPYMVA Sbjct: 338 HIGDIAYANGYLSQWDQFTAQVEPIASTVPYMVA 371 >ref|XP_002512077.1| hydrolase, putative [Ricinus communis] gi|223549257|gb|EEF50746.1| hydrolase, putative [Ricinus communis] Length = 615 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 480 YFGDLAYANGYISQWDQFTSQVEPIASTVPYMVA 581 + GD+ YANGYISQWDQFTSQVEPIASTVPYM+A Sbjct: 335 HIGDICYANGYISQWDQFTSQVEPIASTVPYMIA 368 >ref|XP_002322254.1| predicted protein [Populus trichocarpa] gi|222869250|gb|EEF06381.1| predicted protein [Populus trichocarpa] Length = 587 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 480 YFGDLAYANGYISQWDQFTSQVEPIASTVPYMVA 581 + GD+ YANGYISQWDQFTSQVEPIASTVPYM+A Sbjct: 309 HIGDITYANGYISQWDQFTSQVEPIASTVPYMIA 342 >ref|NP_199851.2| purple acid phosphatase 27 [Arabidopsis thaliana] gi|75222988|sp|Q5MAU8.1|PPA27_ARATH RecName: Full=Probable inactive purple acid phosphatase 27; Flags: Precursor gi|56788345|gb|AAW29951.1| putative purple acid phosphatase [Arabidopsis thaliana] gi|332008556|gb|AED95939.1| purple acid phosphatase 27 [Arabidopsis thaliana] Length = 611 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 480 YFGDLAYANGYISQWDQFTSQVEPIASTVPYMVA 581 + GD+ YANGYISQWDQFT+QVEPIASTVPYMVA Sbjct: 331 HIGDITYANGYISQWDQFTAQVEPIASTVPYMVA 364 >dbj|BAB09459.1| unnamed protein product [Arabidopsis thaliana] Length = 529 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 480 YFGDLAYANGYISQWDQFTSQVEPIASTVPYMVA 581 + GD+ YANGYISQWDQFT+QVEPIASTVPYMVA Sbjct: 249 HIGDITYANGYISQWDQFTAQVEPIASTVPYMVA 282