BLASTX nr result
ID: Paeonia25_contig00055460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00055460 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCL98407.1| predicted protein [Fibroporia radiculosa] 59 5e-07 >emb|CCL98407.1| predicted protein [Fibroporia radiculosa] Length = 621 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/51 (47%), Positives = 34/51 (66%) Frame = -1 Query: 301 STHWQVVSHVCRGWRTVAIGCSGLWSNISLSWKPVHKDEFISRSKQASLSI 149 S HW +HVC+ WR VA+ C LWS++ +SW+ DE + RS+QA L+I Sbjct: 91 SRHWITPTHVCKYWREVALSCPALWSSLVVSWRQEWMDEVLRRSRQAPLAI 141