BLASTX nr result
ID: Paeonia25_contig00055023
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00055023 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310520.1| pentatricopeptide repeat-containing family p... 59 5e-07 >ref|XP_002310520.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222853423|gb|EEE90970.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 710 Score = 59.3 bits (142), Expect = 5e-07 Identities = 34/64 (53%), Positives = 39/64 (60%), Gaps = 5/64 (7%) Frame = -2 Query: 304 VNVFMVKDKNHPQKKEIYXXXXXXXXXXXQVGYVPDASHFEA-----EDELTSCYQMELP 140 V+VFMVKDK HPQKKEIY Q GYVPDAS EA E E +SC+ ME+ Sbjct: 645 VHVFMVKDKRHPQKKEIYSILKLLTKHMRQAGYVPDASDHEAYEEPSELESSSCFHMEMQ 704 Query: 139 AYSA 128 A +A Sbjct: 705 AEAA 708