BLASTX nr result
ID: Paeonia25_contig00054498
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00054498 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFN70435.1| multiprotein bridging factor 1 transcriptional co... 78 1e-12 ref|XP_007013216.1| Multiprotein bridging factor 1C [Theobroma c... 75 7e-12 ref|XP_006298630.1| hypothetical protein CARUB_v10014716mg [Caps... 75 7e-12 ref|XP_007202731.1| hypothetical protein PRUPE_ppa013016mg [Prun... 75 1e-11 ref|XP_002324409.1| ethylene-responsive transcriptional coactiva... 74 3e-11 ref|XP_004139340.1| PREDICTED: multiprotein-bridging factor 1c-l... 73 4e-11 ref|XP_002284605.1| PREDICTED: multiprotein-bridging factor 1c [... 73 4e-11 emb|CAN79519.1| hypothetical protein VITISV_034625 [Vitis vinifera] 73 4e-11 ref|XP_006418740.1| hypothetical protein EUTSA_v10002703mg [Eutr... 72 6e-11 ref|NP_189093.1| multiprotein-bridging factor 1c [Arabidopsis th... 71 1e-10 ref|NP_001189962.1| multiprotein-bridging factor 1c [Arabidopsis... 71 1e-10 gb|AAM62814.1| ethylene-responsive transcriptional coactivator, ... 71 1e-10 ref|XP_002883523.1| ATMBF1C/MBF1C [Arabidopsis lyrata subsp. lyr... 71 2e-10 gb|EXB37038.1| Multiprotein-bridging factor 1c [Morus notabilis] 70 2e-10 gb|EXB37036.1| Multiprotein-bridging factor 1c [Morus notabilis] 70 2e-10 ref|XP_002514331.1| Multiprotein-bridging factor, putative [Rici... 70 2e-10 gb|AGQ57014.1| ethylene-responsive transcriptional coactivator [... 70 3e-10 ref|XP_004512966.1| PREDICTED: multiprotein-bridging factor 1c-l... 69 9e-10 ref|XP_003620516.1| Ethylene-responsive transciptional coactivat... 68 1e-09 ref|XP_003620515.1| Ethylene-responsive transciptional coactivat... 68 1e-09 >gb|AFN70435.1| multiprotein bridging factor 1 transcriptional coactivator [Gossypium hirsutum] Length = 145 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +2 Query: 2 QDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 118 QDWEPVVLHKSKPK+ DLRDPKAVNQALRSG PVQT+KK Sbjct: 11 QDWEPVVLHKSKPKAQDLRDPKAVNQALRSGAPVQTIKK 49 >ref|XP_007013216.1| Multiprotein bridging factor 1C [Theobroma cacao] gi|508783579|gb|EOY30835.1| Multiprotein bridging factor 1C [Theobroma cacao] Length = 98 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +2 Query: 2 QDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 118 QDWEPVVLHKSKPK+ +LRDPKAVNQALRSG PVQT+KK Sbjct: 11 QDWEPVVLHKSKPKAQELRDPKAVNQALRSGPPVQTIKK 49 >ref|XP_006298630.1| hypothetical protein CARUB_v10014716mg [Capsella rubella] gi|482567339|gb|EOA31528.1| hypothetical protein CARUB_v10014716mg [Capsella rubella] Length = 190 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/39 (92%), Positives = 36/39 (92%) Frame = +2 Query: 2 QDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 118 QDWEPVVLHKSKPKS DLRDPKAVN ALRSGV VQTVKK Sbjct: 53 QDWEPVVLHKSKPKSQDLRDPKAVNAALRSGVAVQTVKK 91 >ref|XP_007202731.1| hypothetical protein PRUPE_ppa013016mg [Prunus persica] gi|462398262|gb|EMJ03930.1| hypothetical protein PRUPE_ppa013016mg [Prunus persica] Length = 144 Score = 75.1 bits (183), Expect = 1e-11 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +2 Query: 2 QDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 118 QDWEPVV+HKS+PK DLRDPKAVNQALRSG P+QT+KK Sbjct: 11 QDWEPVVIHKSRPKGQDLRDPKAVNQALRSGAPIQTIKK 49 >ref|XP_002324409.1| ethylene-responsive transcriptional coactivator family protein [Populus trichocarpa] gi|222865843|gb|EEF02974.1| ethylene-responsive transcriptional coactivator family protein [Populus trichocarpa] Length = 145 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +2 Query: 2 QDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 118 QDWEPVV+HK+KPKS DLRDPK VN ALRSG PVQT+KK Sbjct: 11 QDWEPVVMHKAKPKSQDLRDPKVVNHALRSGAPVQTIKK 49 >ref|XP_004139340.1| PREDICTED: multiprotein-bridging factor 1c-like [Cucumis sativus] gi|449521076|ref|XP_004167557.1| PREDICTED: multiprotein-bridging factor 1c-like [Cucumis sativus] Length = 145 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +2 Query: 2 QDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 118 QDWEPVVLHK+KPK+ LRDPKAVNQA+RSG PVQTVKK Sbjct: 11 QDWEPVVLHKAKPKAQALRDPKAVNQAIRSGAPVQTVKK 49 >ref|XP_002284605.1| PREDICTED: multiprotein-bridging factor 1c [Vitis vinifera] Length = 144 Score = 73.2 bits (178), Expect = 4e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +2 Query: 2 QDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 118 QDWEPVVLHKSKPK+ +LRDPKAVN+A+RSG PVQT+KK Sbjct: 11 QDWEPVVLHKSKPKAQELRDPKAVNKAIRSGAPVQTLKK 49 >emb|CAN79519.1| hypothetical protein VITISV_034625 [Vitis vinifera] Length = 144 Score = 73.2 bits (178), Expect = 4e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +2 Query: 2 QDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 118 QDWEPVVLHKSKPK+ +LRDPKAVN+A+RSG PVQT+KK Sbjct: 11 QDWEPVVLHKSKPKAQELRDPKAVNKAIRSGAPVQTLKK 49 >ref|XP_006418740.1| hypothetical protein EUTSA_v10002703mg [Eutrema salsugineum] gi|557096668|gb|ESQ37176.1| hypothetical protein EUTSA_v10002703mg [Eutrema salsugineum] Length = 148 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/39 (89%), Positives = 35/39 (89%) Frame = +2 Query: 2 QDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 118 QDWEPVVLHKSK KS DLRDPKAVN ALRSGV VQTVKK Sbjct: 11 QDWEPVVLHKSKQKSQDLRDPKAVNAALRSGVAVQTVKK 49 >ref|NP_189093.1| multiprotein-bridging factor 1c [Arabidopsis thaliana] gi|75274343|sp|Q9LV58.1|MBF1C_ARATH RecName: Full=Multiprotein-bridging factor 1c gi|9294040|dbj|BAB01997.1| ethylene-responsive transcriptional coactivator-like protein [Arabidopsis thaliana] gi|28466837|gb|AAO44027.1| At3g24500 [Arabidopsis thaliana] gi|110735899|dbj|BAE99925.1| putative ethylene-responsive transcriptional coactivator [Arabidopsis thaliana] gi|332643384|gb|AEE76905.1| multiprotein-bridging factor 1c [Arabidopsis thaliana] Length = 148 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +2 Query: 2 QDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 118 QDWEPVVLHKSK KS DLRDPKAVN ALR+GV VQTVKK Sbjct: 11 QDWEPVVLHKSKQKSQDLRDPKAVNAALRNGVAVQTVKK 49 >ref|NP_001189962.1| multiprotein-bridging factor 1c [Arabidopsis thaliana] gi|332643385|gb|AEE76906.1| multiprotein-bridging factor 1c [Arabidopsis thaliana] Length = 97 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +2 Query: 2 QDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 118 QDWEPVVLHKSK KS DLRDPKAVN ALR+GV VQTVKK Sbjct: 11 QDWEPVVLHKSKQKSQDLRDPKAVNAALRNGVAVQTVKK 49 >gb|AAM62814.1| ethylene-responsive transcriptional coactivator, putative [Arabidopsis thaliana] Length = 148 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +2 Query: 2 QDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 118 QDWEPVVLHKSK KS DLRDPKAVN ALR+GV VQTVKK Sbjct: 11 QDWEPVVLHKSKQKSQDLRDPKAVNAALRNGVAVQTVKK 49 >ref|XP_002883523.1| ATMBF1C/MBF1C [Arabidopsis lyrata subsp. lyrata] gi|297329363|gb|EFH59782.1| ATMBF1C/MBF1C [Arabidopsis lyrata subsp. lyrata] Length = 148 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +2 Query: 2 QDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 118 QDWEPV+LHKSK KS DLRDPKAVN ALR+GV VQTVKK Sbjct: 11 QDWEPVILHKSKQKSQDLRDPKAVNAALRNGVAVQTVKK 49 >gb|EXB37038.1| Multiprotein-bridging factor 1c [Morus notabilis] Length = 147 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +2 Query: 2 QDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 118 QDWEPVV+HKSKPK+ LRDPKAVNQALRSG VQTVKK Sbjct: 11 QDWEPVVVHKSKPKAQALRDPKAVNQALRSGAGVQTVKK 49 >gb|EXB37036.1| Multiprotein-bridging factor 1c [Morus notabilis] Length = 147 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +2 Query: 2 QDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 118 QDWEPVV+HKSKPK+ LRDPKAVNQALRSG VQTVKK Sbjct: 11 QDWEPVVVHKSKPKAQALRDPKAVNQALRSGAGVQTVKK 49 >ref|XP_002514331.1| Multiprotein-bridging factor, putative [Ricinus communis] gi|223546787|gb|EEF48285.1| Multiprotein-bridging factor, putative [Ricinus communis] Length = 146 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +2 Query: 2 QDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 118 QDW+PVVL KSK K+ DLRDPKAVNQALRSG PVQT+KK Sbjct: 11 QDWDPVVLRKSKTKAQDLRDPKAVNQALRSGAPVQTIKK 49 >gb|AGQ57014.1| ethylene-responsive transcriptional coactivator [Hevea brasiliensis] Length = 144 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +2 Query: 2 QDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 118 QDWEPVVL KSK K+ DLRDPKAVNQALRSGVPVQ ++K Sbjct: 11 QDWEPVVLRKSKTKAQDLRDPKAVNQALRSGVPVQAIRK 49 >ref|XP_004512966.1| PREDICTED: multiprotein-bridging factor 1c-like [Cicer arietinum] Length = 145 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +2 Query: 2 QDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 118 QDWEP+VLHKSKPK+ DLR+PKAVNQALR+G + TVKK Sbjct: 11 QDWEPIVLHKSKPKAQDLRNPKAVNQALRTGAEILTVKK 49 >ref|XP_003620516.1| Ethylene-responsive transciptional coactivator-like protein [Medicago truncatula] gi|355495531|gb|AES76734.1| Ethylene-responsive transciptional coactivator-like protein [Medicago truncatula] Length = 148 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +2 Query: 2 QDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 118 QDWEPVVLHK+KPK+ DLR+PKAVNQALR+G V TVKK Sbjct: 11 QDWEPVVLHKTKPKAQDLRNPKAVNQALRTGAEVLTVKK 49 >ref|XP_003620515.1| Ethylene-responsive transciptional coactivator-like protein [Medicago truncatula] gi|355495530|gb|AES76733.1| Ethylene-responsive transciptional coactivator-like protein [Medicago truncatula] Length = 146 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +2 Query: 2 QDWEPVVLHKSKPKSHDLRDPKAVNQALRSGVPVQTVKK 118 QDWEPVVLHK+KPK+ DLR+PKAVNQALR+G V TVKK Sbjct: 11 QDWEPVVLHKTKPKAQDLRNPKAVNQALRTGAEVLTVKK 49