BLASTX nr result
ID: Paeonia25_contig00054400
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00054400 (244 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006468264.1| PREDICTED: pentatricopeptide repeat-containi... 147 1e-33 ref|XP_002272135.1| PREDICTED: pentatricopeptide repeat-containi... 144 1e-32 emb|CAN80625.1| hypothetical protein VITISV_032617 [Vitis vinifera] 144 1e-32 ref|XP_006448964.1| hypothetical protein CICLE_v10014263mg [Citr... 144 1e-32 emb|CBI30945.3| unnamed protein product [Vitis vinifera] 137 1e-30 ref|XP_002893611.1| hypothetical protein ARALYDRAFT_336125 [Arab... 135 5e-30 gb|AAG50561.1|AC073506_3 hypothetical protein [Arabidopsis thali... 135 6e-30 ref|NP_174320.2| PPR repeat domain-containing protein [Arabidops... 135 6e-30 ref|XP_006415489.1| hypothetical protein EUTSA_v10006807mg [Eutr... 135 8e-30 ref|XP_007159381.1| hypothetical protein PHAVU_002G233400g [Phas... 134 1e-29 ref|XP_004485976.1| PREDICTED: pentatricopeptide repeat-containi... 134 1e-29 ref|XP_007214696.1| hypothetical protein PRUPE_ppa026763mg, part... 134 1e-29 ref|XP_002531431.1| pentatricopeptide repeat-containing protein,... 134 2e-29 ref|XP_004293531.1| PREDICTED: pentatricopeptide repeat-containi... 133 2e-29 ref|XP_007024973.1| Tetratricopeptide repeat-like superfamily pr... 132 7e-29 ref|XP_007024972.1| Tetratricopeptide repeat (TPR)-like superfam... 132 7e-29 ref|XP_006306792.1| hypothetical protein CARUB_v10008329mg [Caps... 132 7e-29 ref|XP_002316718.1| pentatricopeptide repeat-containing family p... 131 9e-29 gb|EXC33985.1| Pentatricopeptide repeat-containing protein [Moru... 130 2e-28 ref|XP_003547194.1| PREDICTED: pentatricopeptide repeat-containi... 130 2e-28 >ref|XP_006468264.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Citrus sinensis] Length = 837 Score = 147 bits (371), Expect = 1e-33 Identities = 66/78 (84%), Positives = 73/78 (93%) Frame = +3 Query: 9 LGEDEFRHPLVKEICRLIEGRSVWNPKREGELKHLLRSLKPSQVCAVLHSQADERVALKF 188 L EDEFRHPLV+E+CRLIE RS W+PK EGEL++LLRSLKP Q+CAVLHSQADERVAL+F Sbjct: 163 LEEDEFRHPLVREVCRLIELRSAWSPKLEGELRNLLRSLKPRQICAVLHSQADERVALQF 222 Query: 189 FYWADRQWRYRHDPIVYY 242 FYWADRQWRYRHDPIVYY Sbjct: 223 FYWADRQWRYRHDPIVYY 240 >ref|XP_002272135.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Vitis vinifera] Length = 733 Score = 144 bits (364), Expect = 1e-32 Identities = 66/77 (85%), Positives = 69/77 (89%) Frame = +3 Query: 12 GEDEFRHPLVKEICRLIEGRSVWNPKREGELKHLLRSLKPSQVCAVLHSQADERVALKFF 191 GEDE RHPLV+EICRLIE RS WNPK EGEL+HLLRSLKP QVCAVL Q DERVAL+FF Sbjct: 62 GEDESRHPLVREICRLIELRSAWNPKLEGELRHLLRSLKPRQVCAVLQLQTDERVALRFF 121 Query: 192 YWADRQWRYRHDPIVYY 242 YWADRQWRYRHDPIVYY Sbjct: 122 YWADRQWRYRHDPIVYY 138 >emb|CAN80625.1| hypothetical protein VITISV_032617 [Vitis vinifera] Length = 733 Score = 144 bits (364), Expect = 1e-32 Identities = 66/77 (85%), Positives = 69/77 (89%) Frame = +3 Query: 12 GEDEFRHPLVKEICRLIEGRSVWNPKREGELKHLLRSLKPSQVCAVLHSQADERVALKFF 191 GEDE RHPLV+EICRLIE RS WNPK EGEL+HLLRSLKP QVCAVL Q DERVAL+FF Sbjct: 62 GEDESRHPLVREICRLIELRSAWNPKLEGELRHLLRSLKPRQVCAVLQLQTDERVALRFF 121 Query: 192 YWADRQWRYRHDPIVYY 242 YWADRQWRYRHDPIVYY Sbjct: 122 YWADRQWRYRHDPIVYY 138 >ref|XP_006448964.1| hypothetical protein CICLE_v10014263mg [Citrus clementina] gi|557551575|gb|ESR62204.1| hypothetical protein CICLE_v10014263mg [Citrus clementina] Length = 837 Score = 144 bits (363), Expect = 1e-32 Identities = 65/78 (83%), Positives = 72/78 (92%) Frame = +3 Query: 9 LGEDEFRHPLVKEICRLIEGRSVWNPKREGELKHLLRSLKPSQVCAVLHSQADERVALKF 188 L EDEFRHPLV+E+CRLIE RS W+PK EGEL++LLRSLKP Q+CAVL SQADERVAL+F Sbjct: 163 LEEDEFRHPLVREVCRLIELRSAWSPKLEGELRNLLRSLKPRQICAVLRSQADERVALQF 222 Query: 189 FYWADRQWRYRHDPIVYY 242 FYWADRQWRYRHDPIVYY Sbjct: 223 FYWADRQWRYRHDPIVYY 240 >emb|CBI30945.3| unnamed protein product [Vitis vinifera] Length = 796 Score = 137 bits (346), Expect = 1e-30 Identities = 63/74 (85%), Positives = 66/74 (89%) Frame = +3 Query: 12 GEDEFRHPLVKEICRLIEGRSVWNPKREGELKHLLRSLKPSQVCAVLHSQADERVALKFF 191 GEDE RHPLV+EICRLIE RS WNPK EGEL+HLLRSLKP QVCAVL Q DERVAL+FF Sbjct: 156 GEDESRHPLVREICRLIELRSAWNPKLEGELRHLLRSLKPRQVCAVLQLQTDERVALRFF 215 Query: 192 YWADRQWRYRHDPI 233 YWADRQWRYRHDPI Sbjct: 216 YWADRQWRYRHDPI 229 >ref|XP_002893611.1| hypothetical protein ARALYDRAFT_336125 [Arabidopsis lyrata subsp. lyrata] gi|297339453|gb|EFH69870.1| hypothetical protein ARALYDRAFT_336125 [Arabidopsis lyrata subsp. lyrata] Length = 814 Score = 135 bits (341), Expect = 5e-30 Identities = 63/79 (79%), Positives = 70/79 (88%) Frame = +3 Query: 6 DLGEDEFRHPLVKEICRLIEGRSVWNPKREGELKHLLRSLKPSQVCAVLHSQADERVALK 185 D+ EDE RHPLV+EI RLI RS WNPK EG++++LLRSLKPSQVCAVL SQ DERVALK Sbjct: 136 DVEEDESRHPLVREIGRLIGLRSSWNPKHEGQMRNLLRSLKPSQVCAVLRSQDDERVALK 195 Query: 186 FFYWADRQWRYRHDPIVYY 242 FFYWADRQWRYRHDP+VYY Sbjct: 196 FFYWADRQWRYRHDPMVYY 214 >gb|AAG50561.1|AC073506_3 hypothetical protein [Arabidopsis thaliana] Length = 802 Score = 135 bits (340), Expect = 6e-30 Identities = 62/79 (78%), Positives = 70/79 (88%) Frame = +3 Query: 6 DLGEDEFRHPLVKEICRLIEGRSVWNPKREGELKHLLRSLKPSQVCAVLHSQADERVALK 185 D+ EDE RHPLV+E+ RLI RS WNPK EG++++LLRSLKPSQVCAVL SQ DERVALK Sbjct: 133 DVEEDESRHPLVREVGRLIGLRSSWNPKHEGQMRNLLRSLKPSQVCAVLRSQDDERVALK 192 Query: 186 FFYWADRQWRYRHDPIVYY 242 FFYWADRQWRYRHDP+VYY Sbjct: 193 FFYWADRQWRYRHDPMVYY 211 >ref|NP_174320.2| PPR repeat domain-containing protein [Arabidopsis thaliana] gi|332193082|gb|AEE31203.1| PPR repeat domain-containing protein [Arabidopsis thaliana] Length = 806 Score = 135 bits (340), Expect = 6e-30 Identities = 62/79 (78%), Positives = 70/79 (88%) Frame = +3 Query: 6 DLGEDEFRHPLVKEICRLIEGRSVWNPKREGELKHLLRSLKPSQVCAVLHSQADERVALK 185 D+ EDE RHPLV+E+ RLI RS WNPK EG++++LLRSLKPSQVCAVL SQ DERVALK Sbjct: 133 DVEEDESRHPLVREVGRLIGLRSSWNPKHEGQMRNLLRSLKPSQVCAVLRSQDDERVALK 192 Query: 186 FFYWADRQWRYRHDPIVYY 242 FFYWADRQWRYRHDP+VYY Sbjct: 193 FFYWADRQWRYRHDPMVYY 211 >ref|XP_006415489.1| hypothetical protein EUTSA_v10006807mg [Eutrema salsugineum] gi|557093260|gb|ESQ33842.1| hypothetical protein EUTSA_v10006807mg [Eutrema salsugineum] Length = 820 Score = 135 bits (339), Expect = 8e-30 Identities = 63/79 (79%), Positives = 69/79 (87%) Frame = +3 Query: 6 DLGEDEFRHPLVKEICRLIEGRSVWNPKREGELKHLLRSLKPSQVCAVLHSQADERVALK 185 D+ EDE RHPLV+E RLI RS WNPK EG++++LLRSLKPSQVCAVL SQ DERVALK Sbjct: 143 DVEEDESRHPLVRETNRLIGLRSSWNPKHEGQMRNLLRSLKPSQVCAVLRSQDDERVALK 202 Query: 186 FFYWADRQWRYRHDPIVYY 242 FFYWADRQWRYRHDPIVYY Sbjct: 203 FFYWADRQWRYRHDPIVYY 221 >ref|XP_007159381.1| hypothetical protein PHAVU_002G233400g [Phaseolus vulgaris] gi|561032796|gb|ESW31375.1| hypothetical protein PHAVU_002G233400g [Phaseolus vulgaris] Length = 785 Score = 134 bits (338), Expect = 1e-29 Identities = 60/79 (75%), Positives = 67/79 (84%) Frame = +3 Query: 6 DLGEDEFRHPLVKEICRLIEGRSVWNPKREGELKHLLRSLKPSQVCAVLHSQADERVALK 185 ++GE E RHPLV+E+CRLI RS WNP EG L+HLLRSLKP VCAVL SQADERVAL Sbjct: 118 EIGEAELRHPLVREVCRLITLRSDWNPNFEGHLRHLLRSLKPPLVCAVLRSQADERVALN 177 Query: 186 FFYWADRQWRYRHDPIVYY 242 +FYWADRQWRYRHDP+VYY Sbjct: 178 YFYWADRQWRYRHDPVVYY 196 >ref|XP_004485976.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic-like [Cicer arietinum] Length = 784 Score = 134 bits (338), Expect = 1e-29 Identities = 60/79 (75%), Positives = 66/79 (83%) Frame = +3 Query: 6 DLGEDEFRHPLVKEICRLIEGRSVWNPKREGELKHLLRSLKPSQVCAVLHSQADERVALK 185 ++ E EFRHPLV+E+CRLI RS WNPK EG L+HLLRSLKP VCAVL SQ DER+AL Sbjct: 113 EIDESEFRHPLVREVCRLITLRSTWNPKFEGNLRHLLRSLKPPLVCAVLRSQVDERIALS 172 Query: 186 FFYWADRQWRYRHDPIVYY 242 FFYWADRQWRYRHD IVYY Sbjct: 173 FFYWADRQWRYRHDTIVYY 191 >ref|XP_007214696.1| hypothetical protein PRUPE_ppa026763mg, partial [Prunus persica] gi|462410561|gb|EMJ15895.1| hypothetical protein PRUPE_ppa026763mg, partial [Prunus persica] Length = 802 Score = 134 bits (338), Expect = 1e-29 Identities = 60/76 (78%), Positives = 69/76 (90%) Frame = +3 Query: 15 EDEFRHPLVKEICRLIEGRSVWNPKREGELKHLLRSLKPSQVCAVLHSQADERVALKFFY 194 EDEFRHPLV+E+CRL+E RS WNPK EG+L++LLRSLK QVCAVL SQADERVAL+FFY Sbjct: 130 EDEFRHPLVREVCRLLELRSGWNPKLEGQLRNLLRSLKARQVCAVLRSQADERVALEFFY 189 Query: 195 WADRQWRYRHDPIVYY 242 WADRQWRY+H P+VYY Sbjct: 190 WADRQWRYKHYPVVYY 205 >ref|XP_002531431.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528950|gb|EEF30943.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 737 Score = 134 bits (336), Expect = 2e-29 Identities = 59/79 (74%), Positives = 68/79 (86%) Frame = +3 Query: 6 DLGEDEFRHPLVKEICRLIEGRSVWNPKREGELKHLLRSLKPSQVCAVLHSQADERVALK 185 ++ E+EFRHPLV+E+CRLIE RS WN K EG+L+ LLRSLKP QVCAVL Q+DER+AL Sbjct: 62 EIEEEEFRHPLVREVCRLIERRSAWNAKLEGDLRRLLRSLKPRQVCAVLQLQSDERIALD 121 Query: 186 FFYWADRQWRYRHDPIVYY 242 FFYWA RQWRYRHDPIVYY Sbjct: 122 FFYWAGRQWRYRHDPIVYY 140 >ref|XP_004293531.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 734 Score = 133 bits (335), Expect = 2e-29 Identities = 61/79 (77%), Positives = 67/79 (84%) Frame = +3 Query: 6 DLGEDEFRHPLVKEICRLIEGRSVWNPKREGELKHLLRSLKPSQVCAVLHSQADERVALK 185 D EDE+RHPLV+E+ RLIE R+ W PK EGEL+HLLR LKP QVCAVL SQADERVAL Sbjct: 59 DGDEDEYRHPLVREVGRLIEMRTAWTPKFEGELRHLLRGLKPKQVCAVLKSQADERVALN 118 Query: 186 FFYWADRQWRYRHDPIVYY 242 FFYWADRQWRY+HD IVYY Sbjct: 119 FFYWADRQWRYKHDQIVYY 137 >ref|XP_007024973.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] gi|590622167|ref|XP_007024974.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] gi|590622170|ref|XP_007024975.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] gi|508780339|gb|EOY27595.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] gi|508780340|gb|EOY27596.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] gi|508780341|gb|EOY27597.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] Length = 848 Score = 132 bits (331), Expect = 7e-29 Identities = 61/79 (77%), Positives = 69/79 (87%) Frame = +3 Query: 6 DLGEDEFRHPLVKEICRLIEGRSVWNPKREGELKHLLRSLKPSQVCAVLHSQADERVALK 185 +L EDEFRHPLV+EICRLI+ RS WN K E +L++LLRSLKP QVCAVL SQ DERVAL+ Sbjct: 178 ELEEDEFRHPLVREICRLIQLRSAWNAKLESDLRYLLRSLKPRQVCAVLLSQVDERVALE 237 Query: 186 FFYWADRQWRYRHDPIVYY 242 FFYWADRQWRYRH+ IVYY Sbjct: 238 FFYWADRQWRYRHNLIVYY 256 >ref|XP_007024972.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508780338|gb|EOY27594.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] Length = 761 Score = 132 bits (331), Expect = 7e-29 Identities = 61/79 (77%), Positives = 69/79 (87%) Frame = +3 Query: 6 DLGEDEFRHPLVKEICRLIEGRSVWNPKREGELKHLLRSLKPSQVCAVLHSQADERVALK 185 +L EDEFRHPLV+EICRLI+ RS WN K E +L++LLRSLKP QVCAVL SQ DERVAL+ Sbjct: 91 ELEEDEFRHPLVREICRLIQLRSAWNAKLESDLRYLLRSLKPRQVCAVLLSQVDERVALE 150 Query: 186 FFYWADRQWRYRHDPIVYY 242 FFYWADRQWRYRH+ IVYY Sbjct: 151 FFYWADRQWRYRHNLIVYY 169 >ref|XP_006306792.1| hypothetical protein CARUB_v10008329mg [Capsella rubella] gi|565498308|ref|XP_006306793.1| hypothetical protein CARUB_v10008329mg [Capsella rubella] gi|482575503|gb|EOA39690.1| hypothetical protein CARUB_v10008329mg [Capsella rubella] gi|482575504|gb|EOA39691.1| hypothetical protein CARUB_v10008329mg [Capsella rubella] Length = 810 Score = 132 bits (331), Expect = 7e-29 Identities = 61/76 (80%), Positives = 67/76 (88%) Frame = +3 Query: 15 EDEFRHPLVKEICRLIEGRSVWNPKREGELKHLLRSLKPSQVCAVLHSQADERVALKFFY 194 EDE RHPLV+EI RLI RS WNPK E ++++LLRSLKPSQVCAVL SQ DERVALKFFY Sbjct: 137 EDESRHPLVREIGRLIGLRSSWNPKHEAQMRNLLRSLKPSQVCAVLRSQEDERVALKFFY 196 Query: 195 WADRQWRYRHDPIVYY 242 WADRQWRYRHDP+VYY Sbjct: 197 WADRQWRYRHDPMVYY 212 >ref|XP_002316718.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222859783|gb|EEE97330.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 684 Score = 131 bits (330), Expect = 9e-29 Identities = 59/78 (75%), Positives = 68/78 (87%) Frame = +3 Query: 6 DLGEDEFRHPLVKEICRLIEGRSVWNPKREGELKHLLRSLKPSQVCAVLHSQADERVALK 185 ++ EDEFRHPLV+EICRLIE RS WN K EG+++HLLR LKP VCAVL SQ+DERVAL Sbjct: 9 EIHEDEFRHPLVREICRLIECRSAWNHKLEGKMRHLLRGLKPRLVCAVLLSQSDERVALD 68 Query: 186 FFYWADRQWRYRHDPIVY 239 FF+W+DRQWRYRHDPIVY Sbjct: 69 FFFWSDRQWRYRHDPIVY 86 >gb|EXC33985.1| Pentatricopeptide repeat-containing protein [Morus notabilis] Length = 898 Score = 130 bits (327), Expect = 2e-28 Identities = 58/76 (76%), Positives = 65/76 (85%) Frame = +3 Query: 15 EDEFRHPLVKEICRLIEGRSVWNPKREGELKHLLRSLKPSQVCAVLHSQADERVALKFFY 194 E + RHPLV+E+CRL++ RS WNPK EGEL+HLLRSLKP QVC VL S DERVALKFFY Sbjct: 129 EGQLRHPLVREVCRLVDLRSTWNPKHEGELRHLLRSLKPRQVCDVLRSFDDERVALKFFY 188 Query: 195 WADRQWRYRHDPIVYY 242 WADRQWRYRH+ IVYY Sbjct: 189 WADRQWRYRHNSIVYY 204 >ref|XP_003547194.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like [Glycine max] Length = 793 Score = 130 bits (327), Expect = 2e-28 Identities = 57/79 (72%), Positives = 65/79 (82%) Frame = +3 Query: 6 DLGEDEFRHPLVKEICRLIEGRSVWNPKREGELKHLLRSLKPSQVCAVLHSQADERVALK 185 ++G+ EFRHP+V+E+CRLI S WNP EG L+HLLRSLKP VCAVL SQADERVAL Sbjct: 126 EIGDSEFRHPVVREVCRLITLSSAWNPNFEGRLRHLLRSLKPPLVCAVLRSQADERVALN 185 Query: 186 FFYWADRQWRYRHDPIVYY 242 FFYWADRQWRY H P+VYY Sbjct: 186 FFYWADRQWRYSHHPVVYY 204