BLASTX nr result
ID: Paeonia25_contig00054380
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00054380 (238 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74558.1| hypothetical protein M569_00197, partial [Genlise... 57 3e-06 ref|XP_002314418.1| hypothetical protein POPTR_0010s03120g [Popu... 56 6e-06 >gb|EPS74558.1| hypothetical protein M569_00197, partial [Genlisea aurea] Length = 442 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -3 Query: 113 CTRYGLFKGANFVWLMHFLMIICFSITYTIGKV 15 CTRYGL GANFVWL+ FLMIIC+ I Y IGK+ Sbjct: 143 CTRYGLAVGANFVWLVRFLMIICYPIAYPIGKI 175 >ref|XP_002314418.1| hypothetical protein POPTR_0010s03120g [Populus trichocarpa] gi|222863458|gb|EEF00589.1| hypothetical protein POPTR_0010s03120g [Populus trichocarpa] Length = 502 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -3 Query: 119 SYCTRYGLFKGANFVWLMHFLMIICFSITYTIGKV 15 S CTRYGL GANFVWL+ LMI+C+ I+Y IGKV Sbjct: 138 SICTRYGLAVGANFVWLVRILMILCYPISYPIGKV 172