BLASTX nr result
ID: Paeonia25_contig00054139
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00054139 (252 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P80915.1|AMP1_MACIN RecName: Full=Antimicrobial peptide 1; Sh... 52 3e-06 pdb|1C01|A Chain A, Solution Structure Of Miamp1, A Plant Antimi... 52 3e-06 ref|XP_006843120.1| hypothetical protein AMTR_s00140p00096690 [A... 57 3e-06 >sp|P80915.1|AMP1_MACIN RecName: Full=Antimicrobial peptide 1; Short=AMP1; AltName: Full=MiAMP1; Flags: Precursor gi|2181943|emb|CAA71842.1| AMP1 [Macadamia integrifolia] Length = 102 Score = 51.6 bits (122), Expect(2) = 3e-06 Identities = 23/43 (53%), Positives = 27/43 (62%) Frame = -1 Query: 195 FSYTGQTARLYNTGNCLGGSVATLNGNARQCSGVGWRSINIQC 67 FSYTGQTA LYN C G + +AR C+ GW+SI IQC Sbjct: 60 FSYTGQTAALYNQAGCSGVAHTRFGSSARACNPFGWKSIFIQC 102 Score = 25.0 bits (53), Expect(2) = 3e-06 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 244 YSNCGCSNLLYMGGY 200 YS CGCS + GGY Sbjct: 44 YSKCGCSAIHQKGGY 58 >pdb|1C01|A Chain A, Solution Structure Of Miamp1, A Plant Antimicrobial Protein Length = 76 Score = 51.6 bits (122), Expect(2) = 3e-06 Identities = 23/43 (53%), Positives = 27/43 (62%) Frame = -1 Query: 195 FSYTGQTARLYNTGNCLGGSVATLNGNARQCSGVGWRSINIQC 67 FSYTGQTA LYN C G + +AR C+ GW+SI IQC Sbjct: 34 FSYTGQTAALYNQAGCSGVAHTRFGSSARACNPFGWKSIFIQC 76 Score = 25.0 bits (53), Expect(2) = 3e-06 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 244 YSNCGCSNLLYMGGY 200 YS CGCS + GGY Sbjct: 18 YSKCGCSAIHQKGGY 32 >ref|XP_006843120.1| hypothetical protein AMTR_s00140p00096690 [Amborella trichopoda] gi|548845330|gb|ERN04795.1| hypothetical protein AMTR_s00140p00096690 [Amborella trichopoda] Length = 104 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 198 QFSYTGQTARLYNTGNCLGGSVATLNGNARQCSGVGWRSINIQC 67 QF YTGQTA LYN GNC G + A CS GWRSI IQC Sbjct: 61 QFVYTGQTAALYNQGNCQGVAHTRFGSGASSCSAFGWRSIFIQC 104