BLASTX nr result
ID: Paeonia25_contig00051111
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00051111 (807 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCM02182.1| predicted protein [Fibroporia radiculosa] 58 5e-06 >emb|CCM02182.1| predicted protein [Fibroporia radiculosa] Length = 556 Score = 57.8 bits (138), Expect = 5e-06 Identities = 35/97 (36%), Positives = 49/97 (50%), Gaps = 9/97 (9%) Frame = +2 Query: 278 MQKRKRQEEDSILPLRVSKHPRAVYAYP----SEDNYSEGLTSRWMKLFAETFALIRDTL 445 M RKRQ D++LPLR +K PR +P S ++EGL++RWM+L E + L RDTL Sbjct: 1 MNARKRQATDTLLPLRSAKQPRLTRFHPLGEVSTPTHNEGLSARWMRLGVEMYNLARDTL 60 Query: 446 TQGAD-----VLRPPVEEEQSKAPTPQPKLRARQCKP 541 D P S++ +P P + R P Sbjct: 61 FHWVDGASNSKTLPTTVAGPSQSHSPSPSIPPRPSAP 97