BLASTX nr result
ID: Paeonia25_contig00051006
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00051006 (399 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPT02445.1| hypothetical protein FOMPIDRAFT_1015252 [Fomitops... 57 3e-06 >gb|EPT02445.1| hypothetical protein FOMPIDRAFT_1015252 [Fomitopsis pinicola FP-58527 SS1] Length = 430 Score = 56.6 bits (135), Expect = 3e-06 Identities = 40/115 (34%), Positives = 59/115 (51%), Gaps = 8/115 (6%) Frame = -2 Query: 398 GALVDDKETLVNCALVCRAWLPIARYNLYYSVALVSDRQWTAFERVLSEA--ETSGLSRY 225 G L DD+ TL C+LV RAWLP AR + ++S+ L S + + FE +L A + L+RY Sbjct: 23 GFLWDDQPTLGACSLVARAWLPAARSHKFHSLRLQSCYRRSGFEELLDSALLNSRSLTRY 82 Query: 224 LGKVRALYVIPW------PPSEDREWTDTALLRCSKYLTGLNTIHLNHANWSVSL 78 + ++R + V P P + W D L+R L L + L + W SL Sbjct: 83 VCELR-IGVDPQDNAVCEPKVQRAVWHDLGLIRLLHELPALEVLRLENLWWDPSL 136