BLASTX nr result
ID: Paeonia25_contig00050891
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00050891 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS99631.1| hypothetical protein FOMPIDRAFT_75695 [Fomitopsis... 61 1e-07 ref|XP_007368839.1| Rgp1-domain-containing protein [Dichomitus s... 61 1e-07 gb|EIW65081.1| Rgp1-domain-containing protein [Trametes versicol... 61 2e-07 gb|EMD41460.1| hypothetical protein CERSUDRAFT_110035 [Ceriporio... 60 4e-07 gb|ETW87730.1| hypothetical protein HETIRDRAFT_457174 [Heterobas... 58 2e-06 ref|XP_003026602.1| hypothetical protein SCHCODRAFT_71087 [Schiz... 57 2e-06 gb|EPQ61232.1| Rgp1-domain-containing protein [Gloeophyllum trab... 57 3e-06 ref|XP_007390135.1| hypothetical protein PHACADRAFT_110305 [Phan... 57 3e-06 ref|XP_001888697.1| predicted protein [Laccaria bicolor S238N-H8... 56 5e-06 ref|XP_007323707.1| hypothetical protein SERLADRAFT_443044 [Serp... 55 8e-06 >gb|EPS99631.1| hypothetical protein FOMPIDRAFT_75695 [Fomitopsis pinicola FP-58527 SS1] Length = 932 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 2 VRVEMVECEVPIKVWPGNTAFKATQIVFDV 91 VR EMVECEVPI+VWPGNTAFKAT++VFDV Sbjct: 903 VRAEMVECEVPIRVWPGNTAFKATEVVFDV 932 >ref|XP_007368839.1| Rgp1-domain-containing protein [Dichomitus squalens LYAD-421 SS1] gi|395326064|gb|EJF58478.1| Rgp1-domain-containing protein [Dichomitus squalens LYAD-421 SS1] Length = 956 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = +2 Query: 2 VRVEMVECEVPIKVWPGNTAFKATQIVFDV 91 V+VEMVECEVP++VWPGNTAFKAT++VFDV Sbjct: 927 VKVEMVECEVPVRVWPGNTAFKATEVVFDV 956 >gb|EIW65081.1| Rgp1-domain-containing protein [Trametes versicolor FP-101664 SS1] Length = 950 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 2 VRVEMVECEVPIKVWPGNTAFKATQIVFDV 91 V+VEMVECEVP++VWPGNTAFKAT IVFDV Sbjct: 921 VKVEMVECEVPVRVWPGNTAFKATDIVFDV 950 >gb|EMD41460.1| hypothetical protein CERSUDRAFT_110035 [Ceriporiopsis subvermispora B] Length = 944 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 2 VRVEMVECEVPIKVWPGNTAFKATQIVFDV 91 VR EMVECEVPI+VWPGNTAFKAT++VF+V Sbjct: 915 VRAEMVECEVPIRVWPGNTAFKATEVVFEV 944 >gb|ETW87730.1| hypothetical protein HETIRDRAFT_457174 [Heterobasidion irregulare TC 32-1] Length = 1011 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 2 VRVEMVECEVPIKVWPGNTAFKATQIVFDV 91 VRVE VECEVP+KVWPGNTAF+A ++VFDV Sbjct: 982 VRVETVECEVPVKVWPGNTAFRAMEVVFDV 1011 >ref|XP_003026602.1| hypothetical protein SCHCODRAFT_71087 [Schizophyllum commune H4-8] gi|300100285|gb|EFI91699.1| hypothetical protein SCHCODRAFT_71087 [Schizophyllum commune H4-8] Length = 886 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 2 VRVEMVECEVPIKVWPGNTAFKATQIVFDV 91 VRVE VECE+PIKVWPGNTAFKA +VFDV Sbjct: 857 VRVETVECELPIKVWPGNTAFKALDVVFDV 886 >gb|EPQ61232.1| Rgp1-domain-containing protein [Gloeophyllum trabeum ATCC 11539] Length = 933 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 2 VRVEMVECEVPIKVWPGNTAFKATQIVFDV 91 ++VE VECEVPIKVWPGNTAFKA ++VFDV Sbjct: 904 LKVETVECEVPIKVWPGNTAFKAMEVVFDV 933 >ref|XP_007390135.1| hypothetical protein PHACADRAFT_110305 [Phanerochaete carnosa HHB-10118-sp] gi|409051211|gb|EKM60687.1| hypothetical protein PHACADRAFT_110305 [Phanerochaete carnosa HHB-10118-sp] Length = 895 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 2 VRVEMVECEVPIKVWPGNTAFKATQIVFDV 91 VR EMVECEVPI+VWPGNTAFKA +VF+V Sbjct: 866 VRAEMVECEVPIRVWPGNTAFKAADVVFEV 895 >ref|XP_001888697.1| predicted protein [Laccaria bicolor S238N-H82] gi|164636392|gb|EDR00688.1| predicted protein [Laccaria bicolor S238N-H82] Length = 945 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 2 VRVEMVECEVPIKVWPGNTAFKATQIVFDV 91 V++E VECEVPIKVWPGNTAFKA +VFDV Sbjct: 916 VKLETVECEVPIKVWPGNTAFKAMDVVFDV 945 >ref|XP_007323707.1| hypothetical protein SERLADRAFT_443044 [Serpula lacrymans var. lacrymans S7.9] gi|336365797|gb|EGN94146.1| hypothetical protein SERLA73DRAFT_78067 [Serpula lacrymans var. lacrymans S7.3] gi|336378416|gb|EGO19574.1| hypothetical protein SERLADRAFT_443044 [Serpula lacrymans var. lacrymans S7.9] Length = 934 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 2 VRVEMVECEVPIKVWPGNTAFKATQIVFDV 91 V+VE VECEVPI VWPGNTAFKA +VFDV Sbjct: 905 VKVETVECEVPISVWPGNTAFKAMDVVFDV 934