BLASTX nr result
ID: Paeonia25_contig00050829
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00050829 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS59454.1| hypothetical protein M569_15352, partial [Genlise... 55 1e-05 >gb|EPS59454.1| hypothetical protein M569_15352, partial [Genlisea aurea] Length = 791 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/65 (43%), Positives = 39/65 (60%) Frame = +2 Query: 143 KNTIGNEQCASFVTSNLATVAEYILLMILMLLVCHFLHALLKRFNQPRIVAETITGLFFG 322 KNT +T LAT+A Y+L ++ +C+FLH LL+ +QPRI++E I GLF Sbjct: 1 KNTTSALCTNGGMTYKLATIAVYMLGFFFIVFLCNFLHLLLRPLSQPRIISECIVGLFLS 60 Query: 323 NLKFI 337 NL I Sbjct: 61 NLPVI 65