BLASTX nr result
ID: Paeonia25_contig00050726
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00050726 (342 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006843920.1| hypothetical protein AMTR_s00007p00269400 [A... 64 2e-08 ref|XP_007012473.1| Sterile alpha motif domain-containing protei... 64 3e-08 ref|XP_007012472.1| Sterile alpha motif domain-containing protei... 64 3e-08 ref|XP_007012471.1| Sterile alpha motif domain-containing protei... 64 3e-08 ref|XP_007012470.1| Sterile alpha motif domain-containing protei... 64 3e-08 ref|XP_007012469.1| Sterile alpha motif domain-containing protei... 64 3e-08 ref|XP_007012468.1| Sterile alpha motif domain-containing protei... 64 3e-08 ref|XP_002309453.1| sterile alpha motif domain-containing family... 64 3e-08 ref|NP_182094.1| sterile alpha motif (SAM) domain-containing pro... 63 4e-08 ref|XP_002882028.1| sterile alpha motif domain-containing protei... 63 4e-08 ref|XP_004501410.1| PREDICTED: DNA cross-link repair protein SNM... 62 6e-08 ref|XP_002280362.2| PREDICTED: uncharacterized protein LOC100256... 62 6e-08 ref|XP_003603243.1| DNA cross-link repair 1A protein [Medicago t... 62 6e-08 emb|CBI20745.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_002516164.1| DNA cross-link repair protein pso2/snm1, put... 62 6e-08 gb|EYU21966.1| hypothetical protein MIMGU_mgv1a0253331mg, partia... 62 8e-08 gb|EMT05587.1| hypothetical protein F775_00976 [Aegilops tauschii] 58 1e-07 ref|XP_006397751.1| hypothetical protein EUTSA_v10001326mg [Eutr... 62 1e-07 ref|XP_006293745.1| hypothetical protein CARUB_v10022707mg [Caps... 61 1e-07 ref|XP_006293744.1| hypothetical protein CARUB_v10022707mg [Caps... 61 1e-07 >ref|XP_006843920.1| hypothetical protein AMTR_s00007p00269400 [Amborella trichopoda] gi|548846288|gb|ERN05595.1| hypothetical protein AMTR_s00007p00269400 [Amborella trichopoda] Length = 858 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -3 Query: 184 ELQYDFLKQEAVTQFVIEAIQAEAFNPNTLFLIGSYMYNRK 62 + QYDF KQEAV QFVIEAIQAEAFNP TLFLIGSY ++ Sbjct: 664 DAQYDFPKQEAVVQFVIEAIQAEAFNPKTLFLIGSYTIGKE 704 >ref|XP_007012473.1| Sterile alpha motif domain-containing protein isoform 6, partial [Theobroma cacao] gi|508782836|gb|EOY30092.1| Sterile alpha motif domain-containing protein isoform 6, partial [Theobroma cacao] Length = 686 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -3 Query: 178 QYDFLKQEAVTQFVIEAIQAEAFNPNTLFLIGSYMYNRK 62 QYDF KQEAV QFVIEAIQAEAFNP TLFLIGSY ++ Sbjct: 569 QYDFPKQEAVIQFVIEAIQAEAFNPKTLFLIGSYTIGKE 607 >ref|XP_007012472.1| Sterile alpha motif domain-containing protein isoform 5, partial [Theobroma cacao] gi|508782835|gb|EOY30091.1| Sterile alpha motif domain-containing protein isoform 5, partial [Theobroma cacao] Length = 680 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -3 Query: 178 QYDFLKQEAVTQFVIEAIQAEAFNPNTLFLIGSYMYNRK 62 QYDF KQEAV QFVIEAIQAEAFNP TLFLIGSY ++ Sbjct: 562 QYDFPKQEAVIQFVIEAIQAEAFNPKTLFLIGSYTIGKE 600 >ref|XP_007012471.1| Sterile alpha motif domain-containing protein isoform 4 [Theobroma cacao] gi|508782834|gb|EOY30090.1| Sterile alpha motif domain-containing protein isoform 4 [Theobroma cacao] Length = 727 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -3 Query: 178 QYDFLKQEAVTQFVIEAIQAEAFNPNTLFLIGSYMYNRK 62 QYDF KQEAV QFVIEAIQAEAFNP TLFLIGSY ++ Sbjct: 557 QYDFPKQEAVIQFVIEAIQAEAFNPKTLFLIGSYTIGKE 595 >ref|XP_007012470.1| Sterile alpha motif domain-containing protein isoform 3 [Theobroma cacao] gi|508782833|gb|EOY30089.1| Sterile alpha motif domain-containing protein isoform 3 [Theobroma cacao] Length = 703 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -3 Query: 178 QYDFLKQEAVTQFVIEAIQAEAFNPNTLFLIGSYMYNRK 62 QYDF KQEAV QFVIEAIQAEAFNP TLFLIGSY ++ Sbjct: 557 QYDFPKQEAVIQFVIEAIQAEAFNPKTLFLIGSYTIGKE 595 >ref|XP_007012469.1| Sterile alpha motif domain-containing protein isoform 2 [Theobroma cacao] gi|508782832|gb|EOY30088.1| Sterile alpha motif domain-containing protein isoform 2 [Theobroma cacao] Length = 745 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -3 Query: 178 QYDFLKQEAVTQFVIEAIQAEAFNPNTLFLIGSYMYNRK 62 QYDF KQEAV QFVIEAIQAEAFNP TLFLIGSY ++ Sbjct: 557 QYDFPKQEAVIQFVIEAIQAEAFNPKTLFLIGSYTIGKE 595 >ref|XP_007012468.1| Sterile alpha motif domain-containing protein isoform 1 [Theobroma cacao] gi|508782831|gb|EOY30087.1| Sterile alpha motif domain-containing protein isoform 1 [Theobroma cacao] Length = 838 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -3 Query: 178 QYDFLKQEAVTQFVIEAIQAEAFNPNTLFLIGSYMYNRK 62 QYDF KQEAV QFVIEAIQAEAFNP TLFLIGSY ++ Sbjct: 557 QYDFPKQEAVIQFVIEAIQAEAFNPKTLFLIGSYTIGKE 595 >ref|XP_002309453.1| sterile alpha motif domain-containing family protein [Populus trichocarpa] gi|222855429|gb|EEE92976.1| sterile alpha motif domain-containing family protein [Populus trichocarpa] Length = 740 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -3 Query: 178 QYDFLKQEAVTQFVIEAIQAEAFNPNTLFLIGSYMYNRK 62 QYDF KQEAV QFVIEAIQAEAFNP TLFLIGSY ++ Sbjct: 552 QYDFPKQEAVIQFVIEAIQAEAFNPKTLFLIGSYTIGKE 590 >ref|NP_182094.1| sterile alpha motif (SAM) domain-containing protein [Arabidopsis thaliana] gi|3386625|gb|AAC28555.1| hypothetical protein [Arabidopsis thaliana] gi|20197051|gb|AAM14896.1| hypothetical protein [Arabidopsis thaliana] gi|28973723|gb|AAO64178.1| unknown protein [Arabidopsis thaliana] gi|29824257|gb|AAP04089.1| unknown protein [Arabidopsis thaliana] gi|110736829|dbj|BAF00373.1| hypothetical protein [Arabidopsis thaliana] gi|330255495|gb|AEC10589.1| sterile alpha motif (SAM) domain-containing protein [Arabidopsis thaliana] Length = 723 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -3 Query: 178 QYDFLKQEAVTQFVIEAIQAEAFNPNTLFLIGSYMYNRK 62 QYDF KQEAV QFV+EAIQAEAFNP TLFLIGSY ++ Sbjct: 535 QYDFPKQEAVIQFVVEAIQAEAFNPKTLFLIGSYTIGKE 573 >ref|XP_002882028.1| sterile alpha motif domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297327867|gb|EFH58287.1| sterile alpha motif domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 721 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -3 Query: 178 QYDFLKQEAVTQFVIEAIQAEAFNPNTLFLIGSYMYNRK 62 QYDF KQEAV QFV+EAIQAEAFNP TLFLIGSY ++ Sbjct: 533 QYDFPKQEAVIQFVVEAIQAEAFNPKTLFLIGSYTIGKE 571 >ref|XP_004501410.1| PREDICTED: DNA cross-link repair protein SNM1-like [Cicer arietinum] Length = 676 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -3 Query: 178 QYDFLKQEAVTQFVIEAIQAEAFNPNTLFLIGSYMYNRK 62 QYDF KQEAV QFVI+AIQAEAFNP TLFLIGSY ++ Sbjct: 488 QYDFPKQEAVIQFVIDAIQAEAFNPRTLFLIGSYTIGKE 526 >ref|XP_002280362.2| PREDICTED: uncharacterized protein LOC100256089 [Vitis vinifera] Length = 842 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -3 Query: 178 QYDFLKQEAVTQFVIEAIQAEAFNPNTLFLIGSYMYNRK 62 QYDF KQEAV QFVI+AIQAEAFNP TLFLIGSY ++ Sbjct: 654 QYDFPKQEAVIQFVIDAIQAEAFNPRTLFLIGSYTIGKE 692 >ref|XP_003603243.1| DNA cross-link repair 1A protein [Medicago truncatula] gi|355492291|gb|AES73494.1| DNA cross-link repair 1A protein [Medicago truncatula] Length = 671 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -3 Query: 178 QYDFLKQEAVTQFVIEAIQAEAFNPNTLFLIGSYMYNRK 62 QYDF KQEAV QFVI+AIQAEAFNP TLFLIGSY ++ Sbjct: 483 QYDFPKQEAVIQFVIDAIQAEAFNPRTLFLIGSYTIGKE 521 >emb|CBI20745.3| unnamed protein product [Vitis vinifera] Length = 723 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -3 Query: 178 QYDFLKQEAVTQFVIEAIQAEAFNPNTLFLIGSYMYNRK 62 QYDF KQEAV QFVI+AIQAEAFNP TLFLIGSY ++ Sbjct: 535 QYDFPKQEAVIQFVIDAIQAEAFNPRTLFLIGSYTIGKE 573 >ref|XP_002516164.1| DNA cross-link repair protein pso2/snm1, putative [Ricinus communis] gi|223544650|gb|EEF46166.1| DNA cross-link repair protein pso2/snm1, putative [Ricinus communis] Length = 737 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -3 Query: 178 QYDFLKQEAVTQFVIEAIQAEAFNPNTLFLIGSYMYNRK 62 QYDF KQEAV QFVIEAIQAE+FNP TLFLIGSY ++ Sbjct: 549 QYDFPKQEAVIQFVIEAIQAESFNPKTLFLIGSYTIGKE 587 >gb|EYU21966.1| hypothetical protein MIMGU_mgv1a0253331mg, partial [Mimulus guttatus] Length = 529 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -3 Query: 184 ELQYDFLKQEAVTQFVIEAIQAEAFNPNTLFLIGSYMYNRK 62 E QYDF KQE V QFVI+AIQAEAFNP TLFLIGSY ++ Sbjct: 340 ESQYDFPKQETVIQFVIDAIQAEAFNPRTLFLIGSYTIGKE 380 >gb|EMT05587.1| hypothetical protein F775_00976 [Aegilops tauschii] Length = 239 Score = 57.8 bits (138), Expect(2) = 1e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -3 Query: 178 QYDFLKQEAVTQFVIEAIQAEAFNPNTLFLIGSY 77 +YDF QE V QFVIEAIQAEAFNP TLFLIGSY Sbjct: 25 RYDFPSQEIVIQFVIEAIQAEAFNPKTLFLIGSY 58 Score = 23.9 bits (50), Expect(2) = 1e-07 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 66 GKEMLSLEVARVLRKK 19 GKE L EVAR+L+KK Sbjct: 86 GKERLFTEVARLLQKK 101 >ref|XP_006397751.1| hypothetical protein EUTSA_v10001326mg [Eutrema salsugineum] gi|557098824|gb|ESQ39204.1| hypothetical protein EUTSA_v10001326mg [Eutrema salsugineum] Length = 740 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -3 Query: 178 QYDFLKQEAVTQFVIEAIQAEAFNPNTLFLIGSYMYNRK 62 QYDF KQE V QFV+EAIQAEAFNP TLFLIGSY ++ Sbjct: 552 QYDFPKQETVIQFVVEAIQAEAFNPKTLFLIGSYTIGKE 590 >ref|XP_006293745.1| hypothetical protein CARUB_v10022707mg [Capsella rubella] gi|482562453|gb|EOA26643.1| hypothetical protein CARUB_v10022707mg [Capsella rubella] Length = 697 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -3 Query: 178 QYDFLKQEAVTQFVIEAIQAEAFNPNTLFLIGSYMYNRK 62 QYDF KQEAV QFV+EAIQAEAFNP LFLIGSY ++ Sbjct: 556 QYDFPKQEAVIQFVVEAIQAEAFNPKALFLIGSYTIGKE 594 >ref|XP_006293744.1| hypothetical protein CARUB_v10022707mg [Capsella rubella] gi|482562452|gb|EOA26642.1| hypothetical protein CARUB_v10022707mg [Capsella rubella] Length = 744 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -3 Query: 178 QYDFLKQEAVTQFVIEAIQAEAFNPNTLFLIGSYMYNRK 62 QYDF KQEAV QFV+EAIQAEAFNP LFLIGSY ++ Sbjct: 556 QYDFPKQEAVIQFVVEAIQAEAFNPKALFLIGSYTIGKE 594